OXA-21

Download Sequences

Accession	ARO:3001416
CARD Short Name	OXA-21
Definition	OXA-21 is a beta-lactamase found in A. baumannii.
AMR Gene Family	OXA beta-lactamase, OXA-2-like beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter nosocomialis^wgs, Acinetobacter pittii^wgs, Aeromonas caviae^g+wgs, Aeromonas veronii^g+wgs, Alcaligenes faecalis^g+gi, Klebsiella pneumoniae^p+wgs, Laribacter hongkongensis^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas monteilii^wgs, Pseudomonas putida^g, Pseudomonas stutzeri^wgs
Resistomes with Sequence Variants	Acinetobacter nosocomialis^wgs, Acinetobacter pittii^wgs, Aeromonas caviae^g+wgs, Aeromonas veronii^g+wgs, Alcaligenes faecalis^g+gi, Klebsiella pneumoniae^p+wgs, Laribacter hongkongensis^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas monteilii^wgs, Pseudomonas putida^g, Pseudomonas stutzeri^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + beta-lactam antibiotic + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + penicillin beta-lactam [Drug Class] + beta-lactamase resistant penicillin + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + class D beta-lactamase + oxacillin [Antibiotic] + OXA beta-lactamase [AMR Gene Family] + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + OXA-2-like beta-lactamase [AMR Gene Family]
Publications	Vila J, et al. 1997. Antimicrob Agents Chemother 41(12): 2757-2759. Cloning and nucleotide sequence analysis of a gene encoding an OXA-derived beta-lactamase in Acinetobacter baumannii. (PMID 9420053)

Resistomes

Prevalence of OXA-21 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter nosocomialis	0%	0%	0.57%	0%	0%
Acinetobacter nosocomialis	0%	0%	0.57%	0%	0%
Acinetobacter pittii	0%	0%	0.85%	0%	0%
Acinetobacter pittii	0%	0%	0.85%	0%	0%
Aeromonas caviae	4.55%	0%	6.45%	0%	0%
Aeromonas caviae	4.55%	0%	6.45%	0%	0%
Aeromonas veronii	1.82%	0%	1.69%	0%	0%
Aeromonas veronii	1.82%	0%	1.69%	0%	0%
Alcaligenes faecalis	5%	0%	0%	33.33%	0%
Alcaligenes faecalis	5%	0%	0%	33.33%	0%
Klebsiella pneumoniae	0%	0.01%	0.01%	0%	0%
Klebsiella pneumoniae	0%	0.01%	0.01%	0%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.06%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.06%	0%	0%
Pseudomonas monteilii	0%	0%	2.38%	0%	0%
Pseudomonas monteilii	0%	0%	2.38%	0%	0%
Pseudomonas putida	1.41%	0%	0%	0%	0%
Pseudomonas putida	1.41%	0%	0%	0%	0%
Pseudomonas stutzeri	0%	0%	1.53%	0%	0%
Pseudomonas stutzeri	0%	0%	1.53%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAA71699.2|+|OXA-21 [Acinetobacter baumannii]
MAIRIFAILFSTFVFGTFAHAQEGMRERSDWRKFFSEFQAKGTIVVADERQTDRVILVFDQVRSEKRYSPASTFKIPHTLFALDAGAARD
EFQVFRWDGIKRSFAAHNQDQDLRSAMRNSTVWIYELFAKEIGEDKARRYLKQIDYGNADPSTSNGDYWIDGNLAIAAQEQIAFLRKLYH
NELPFRVEHQRLVKDLMIVEAGRNWILRAKTGWEGRMGWWVGWVEWPTGPVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVN
SDAAR

>gb|Y10693.2|+|1-828|OXA-21 [Acinetobacter baumannii]
ATGGCAATCCGAATCTTCGCAATACTTTTCTCCACTTTTGTTTTTGGCACGTTCGCGCATGCACAAGAAGGCATGCGCGAACGTTCTGAC
TGGCGGAAGTTTTTCAGCGAATTTCAAGCCAAAGGCACGATAGTTGTGGCAGACGAACGCCAAACAGATCGTGTCATATTGGTTTTTGAT
CAGGTGCGGTCAGAGAAACGCTACTCGCCGGCCTCGACATTCAAGATTCCACATACACTTTTTGCACTTGACGCAGGCGCTGCACGTGAT
GAGTTTCAAGTTTTCCGATGGGACGGCATCAAAAGAAGCTTTGCAGCTCACAACCAAGACCAAGACTTGCGATCAGCAATGCGGAATTCT
ACTGTCTGGATTTATGAGCTATTTGCAAAAGAGATCGGTGAAGACAAGGCTCGACGCTATTTGAAGCAAATCGACTATGGCAACGCCGAT
CCTTCGACAAGTAATGGCGATTACTGGATAGATGGCAATCTTGCTATCGCGGCACAAGAACAGATTGCATTTCTCAGGAAGCTCTATCAT
AACGAGTTGCCCTTTCGGGTAGAACATCAGCGCTTGGTCAAGGACCTCATGATTGTGGAAGCCGGTCGCAACTGGATACTGCGCGCAAAG
ACGGGCTGGGAAGGCCGCATGGGTTGGTGGGTAGGATGGGTTGAGTGGCCGACTGGCCCCGTATTTTTCGCACTGAATATTGATACGCCA
AACAGGATGGATGACCTTTTCAAAAGGGAGGCAATAGTGCGGGCAATCCTTCGCTCTATCGAAGCGTTGCCGCCCAACCCGGCAGTCAAC
TCGGACGCAGCGCGATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

OXA-21

Prevalence: protein homolog model (view sequences)

Graph