OXA-181

Accession ARO:3001784
DefinitionOXA-181 is a beta-lactamase found in Klebsiella pneumoniae
AMR Gene FamilyOXA beta-lactamase
Drug Classpenam, cephalosporin
Resistance Mechanismantibiotic inactivation
ResistomesEnterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiip
Classification21 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ OXA beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin-tazobactam [Antibiotic]
Publications

Potron A, et al. 2011. Antimicrob Agents Chemother 55(10): 4896-4899. Characterization of OXA-181, a carbapenem-hydrolyzing class D beta-lactamase from Klebsiella pneumoniae. (PMID 21768505)

Resistomes

Prevalence of OXA-181 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0.39%
Enterobacter hormaechei0%0.55%0.61%
Escherichia coli0%0.18%0.41%
Klebsiella pneumoniae2%0.23%0.79%
Morganella morganii0%5.26%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AEP16366.1|+|OXA-181 [Klebsiella pneumoniae]
MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGVVKDEH
QVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATQQIAFLRKLYHNK
LHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMDMPTSDGLGLRQAITKEVLKQEKIIP


>gb|JN205800|+|4141-4938|OXA-181 [Klebsiella pneumoniae]
ATGCGTGTATTAGCCTTATCGGCTGTGTTTTTGGTGGCATCGATTATCGGAATGCCAGCGGTAGCAAAGGAATGGCAAGAAAACAAAAGT
TGGAATGCTCACTTTACTGAACATAAATCACAGGGCGTAGTTGTGCTCTGGAATGAGAATAAGCAGCAAGGATTTACCAATAATCTTAAA
CGGGCGAACCAAGCATTTTTACCCGCATCTACCTTTAAAATTCCCAATAGCTTGATCGCCCTCGATTTGGGCGTGGTTAAGGATGAACAC
CAAGTCTTTAAGTGGGATGGACAGACGCGTGATATCGCCGCTTGGAATCGTGACCATGACTTAATTACCGCGATGAAGTACTCAGTTGTG
CCTGTTTATCAAGAATTTGCCCGCCAAATTGGTGAGGCACGTATGAGTAAAATGCTGCACGCCTTCGATTATGGCAATGAGGATATCTCG
GGCAATGTAGACAGTTTTTGGCTCGATGGTGGTATTCGCATTTCGGCTACCCAGCAAATCGCTTTTTTACGCAAGCTGTATCACAACAAG
CTGCACGTTTCTGAGCGTAGTCAGCGCATCGTGAAACAAGCCATGCTGACCGAAGCCAATGGCGACTATATTATTCGGGCTAAAACGGGA
TACTCGACTAGAATCGAACCTAAGATTGGCTGGTGGGTTGGTTGGGTTGAACTTGATGATAATGTGTGGTTTTTTGCGATGAATATGGAT
ATGCCCACATCGGATGGTTTAGGGCTGCGCCAAGCCATCACAAAAGAAGTGCTCAAACAGGAGAAAATTATTCCCTAG