CTX-M-55

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001917
Synonym(s)CTX-M-57
CARD Short NameCTX-M-55
DefinitionCTX-M-55 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classazole antibiotic, cephalosporin, imidazole antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (23), Klebsiella pneumoniae (10), Salmonella (5), Shigella sonnei (2)
GAZChina (8), [Former] State of Korea (4)
FOODONfish (3), swine (3), chicken (2), Bos taurus (2), pork meat food product (2), poultry drumstick (2)
ENVOhospital (3)
UBERONrenal system (2)
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ CTX-M beta-lactamase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ avibactam [Adjuvant] is_small_molecule_inhibitor_of
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Acinetobacter towneriwgs, Citrobacter freundiip, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificusp+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter towneriwgs, Citrobacter freundiip, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificusp+wgs
Publications

Kiratisin P, et al. 2007. Diagn Microbiol Infect Dis 58(3): 349-355. The emergence of a novel ceftazidime-resistant CTX-M extended-spectrum beta-lactamase, CTX-M-55, in both community-onset and hospital-acquired infections in Thailand. (PMID 17449211)

Resistomes

Prevalence of CTX-M-55 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.26%0%0%
Acinetobacter towneri0%0%3.85%0%0%
Citrobacter freundii0%0.31%0%0%0%
Enterobacter cloacae0%0.56%1.28%0%0%
Enterobacter hormaechei0%0.06%0.17%0%0%
Enterobacter roggenkampii0%0.48%0%0%0%
Escherichia albertii0%2.26%0%0%0%
Escherichia coli0.88%1.03%4.03%0.26%0%
Escherichia fergusonii0%0.36%4.35%0%0%
Klebsiella pneumoniae0.06%0.26%0.88%0%0%
Klebsiella quasipneumoniae0%0%0.39%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0%0%0.17%0%0%
Salmonella enterica1.7%2.68%1.47%1.32%0%
Shigella boydii0%0%3.33%0%0%
Shigella flexneri1%2.01%1.55%0%0%
Shigella sonnei0%0.97%1.68%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Vibrio vulnificus0%5.56%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ABI34705.1|+|CTX-M-55 [Escherichia coli]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL


>gb|DQ885477.1|+|1-876|CTX-M-55 [Escherichia coli]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGTGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit