IMP-8

Accession ARO:3002199
Synonym(s)IMP-47
CARD Short NameIMP-8
DefinitionIMP-8 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyIMP beta-lactamase
Drug Classpenem, penam, cephamycin, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAeromonas caviaeg+p, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p, Enterobacter hormaecheiwgs, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs
Resistomes with Sequence VariantsAeromonas caviaeg+p, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p, Enterobacter hormaecheiwgs, Klebsiella pneumoniaep+wgs, Morganella morganiigi, Proteus mirabilisgi, Pseudomonas aeruginosawgs, Pseudomonas putidawgs
Classification18 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ IMP beta-lactamase [AMR Gene Family]
Publications

Yan JJ, et al. 2001. Antimicrob Agents Chemother 45(8): 2368-2371. Identification of a plasmid encoding SHV-12, TEM-1, and a variant of IMP-2 metallo-beta-lactamase, IMP-8, from a clinical isolate of Klebsiella pneumoniae. (PMID 11451699)

Resistomes

Prevalence of IMP-8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Aeromonas caviae2.27%1.3%0%0%
Citrobacter freundii0%0%0.39%0%
Enterobacter asburiae0%0%0.4%0%
Enterobacter cloacae1.79%0.56%0%0%
Enterobacter hormaechei0%0%0.22%0%
Escherichia coli0%0%0%0%
Klebsiella pneumoniae0%0.03%0.01%0%
Morganella morganii0%0%0%7.69%
Proteus mirabilis0%0%0%3.7%
Pseudomonas aeruginosa0%0%0.04%0%
Pseudomonas putida0%0%0.53%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAK13430.1|+|IMP-8 [Klebsiella pneumoniae]
MKKLFVLCVCFLCSITAAGAALPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKG
TISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKP
DGLGNLGDANLEAWPKSAKILMSKYGKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESKKPSQPSN


>gb|AF322577.2|+|2082-2822|IMP-8 [Klebsiella pneumoniae]
ATGAAGAAATTATTTGTTTTATGTGTATGCTTCCTTTGTAGCATTACTGCCGCAGGAGCGGCTTTGCCTGATTTAAAAATCGAGAAGCTT
GAAGAAGGTGTTTATGTTCATACATCGTTCGAAGAAGTTAACGGTTGGGGTGTTGTTTCTAAACACGGTTTGGTGGTTCTTGTAAACACT
GACGCCTATCTGATTGACACTCCATTTACTGCTACAGATACTGAAAAGTTAGTCAATTGGTTTGTGGAGCGCGGCTATAAAATCAAAGGC
ACTATTTCCTCACATTTCCATAGCGACAGCACAGGGGGAATAGAGTGGCTTAATTCTCAATCTATTCCCACGTATGCATCTGAATTAACA
AATGAACTTCTTAAAAAAGACGGTAAGGTGCAAGCTAAAAACTCATTTAGCGGAGTTAGTTATTGGCTAGTTAAAAATAAAATTGAAGTT
TTTTATCCCGGCCCGGGGCACACTCAAGATAACGTAGTGGTTTGGTTACCTGAAAAGAAAATTTTATTCGGTGGTTGTTTTGTTAAACCG
GACGGTCTTGGTAATTTGGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCCAAAATATTAATGTCTAAATATGGTAAAGCAAAACTG
GTTGTTTCAAGTCATAGTGAAATTGGGGACGCATCACTCTTGAAACGTACATGGGAACAGGCTGTTAAAGGGCTAAATGAAAGTAAAAAA
CCATCACAGCCAAGTAACTAA