VIM-4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002274
CARD Short NameVIM-4
DefinitionVIM-4 is a beta-lactamase found in Pseudomonas aeruginosa.
AMR Gene FamilyVIM beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (15), Enterobacter cloacae (10), Klebsiella pneumoniae (8), Escherichia coli (5), Enterobacteriaceae (5), Citrobacter freundii (2), Klebsiella oxytoca (2), Acinetobacter baumannii (2), Enterobacter (2)
GAZHungary (3), Greece (3), Italy (2), Poland (2)
FOODON
ENVOhospital (7)
UBERON
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ VIM beta-lactamase [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas caviaeg, Alcaligenes faecalisg+wgs+gi, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Delftia tsuruhatensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella pneumoniaeg+wgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+wgs+gi, Pseudomonas monteiliiwgs, Serratia marcescenswgs, Stutzerimonas stutzeriwgs
Resistomes with Sequence VariantsAcinetobacter pittiiwgs, Aeromonas caviaeg, Alcaligenes faecalisg+wgs+gi, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Delftia tsuruhatensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Klebsiella pneumoniaeg+wgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+wgs+gi, Pseudomonas monteiliiwgs, Serratia marcescenswgs, Stutzerimonas stutzeriwgs
Publications

Pournaras S, et al. 2002. Antimicrob Agents Chemother 46(12): 4026-4028. Novel variant (bla(VIM-4)) of the metallo-beta-lactamase gene bla(VIM-1) in a clinical strain of Pseudomonas aeruginosa. (PMID 12435718)

Resistomes

Prevalence of VIM-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter pittii0%0%0.85%0%0%
Aeromonas caviae2.27%0%0%0%0%
Alcaligenes faecalis5%0%8.82%33.33%0%
Citrobacter freundii0%0%0.39%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Delftia tsuruhatensis0%0%6.25%0%0%
Enterobacter asburiae0%0%1.58%0%0%
Enterobacter cloacae0%0%7.35%0%0%
Enterobacter hormaechei0%0.45%1.55%0%0%
Enterobacter kobei0%0%0.44%0%0%
Enterobacter roggenkampii0%0%2.52%0%0%
Escherichia coli0%0%0.01%0%0%
Klebsiella pneumoniae0.06%0%0.22%0%0%
Proteus mirabilis0%0%0.5%0%0%
Pseudomonas aeruginosa0.31%0%0.19%1.39%0%
Pseudomonas monteilii0%0%14.29%0%0%
Serratia marcescens0%0%0.26%0%0%
Stutzerimonas stutzeri0%0%0.76%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAJ32502.1|+|VIM-4 [Pseudomonas aeruginosa]
MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK
NTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSANVLYGGCAVHELSRTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE


>gb|AM087411.1|+|128-928|VIM-4 [Pseudomonas aeruginosa]
ATGTTAAAAGTTATTAGTAGTTTATTGGTCTACATGACCGCGTCTGTCATGGCTGTCGCAAGTCCGTTAGCCCATTCCGGGGAGCCGAGT
GGTGAGTATCCGACAGTCAACGAAATTCCGGTCGGAGAGGTCCGACTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAG
TCGTTTGATGGCGCGGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAA
AACACAGCGGCACTTCTCGCGGAGATTGAAAAGCAAATTGGACTTCCCGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTC
GGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGCAGAGGGGAACGAGATT
CCCACGCATTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAGCTCTTCTATCCTGGTGCTGCGCATTCG
ACCGACAATCTGGTTGTATACGTCCCGTCAGCGAACGTGCTATACGGTGGTTGTGCCGTTCATGAGTTGTCACGCACGTCTGCGGGGAAC
GTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCGTTGAGCGGATTCAAAAACACTACCCGGAAGCAGAGGTCGTCATTCCCGGGCAC
GGTCTACCGGGCGGTCTAGACTTGCTCCAGCACACAGCGAACGTTGTCAAAGCACACAAAAATCGCTCAGTCGCCGAGTAG

Curator Acknowledgements
Curator Description Most Recent Edit