NDM-7

Download Sequences

Accession	ARO:3002357
CARD Short Name	NDM-7
Definition	NDM-7 is a beta-lactamase found in Escherichia coli.
AMR Gene Family	NDM beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Providencia rettgeri^wgs, Salmonella enterica^p+wgs
Resistomes with Sequence Variants	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Providencia rettgeri^wgs, Salmonella enterica^p+wgs
Classification	15 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase + beta-lactamase + antibiotic molecule + beta-lactam antibiotic + class B (metallo-) beta-lactamase + subclass B1 (metallo-) beta-lactamase + penicillin beta-lactam [Drug Class] + cephalosporin [Drug Class] + carbapenem [Drug Class]
Parent Term(s)	1 ontology terms \| Show + NDM beta-lactamase [AMR Gene Family]
Publications	Gottig S, et al. 2013. J Antimicrob Chemother 68(8): 1737-1740. Detection of NDM-7 in Germany, a new variant of the New Delhi metallo-beta-lactamase with increased carbapenemase activity. (PMID 23557929)

Resistomes

Prevalence of NDM-7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter freundii	0%	0%	0.39%	0%	0%
Citrobacter freundii	0%	0%	0.39%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Enterobacter hormaechei	0%	0%	0.3%	0%	0%
Enterobacter hormaechei	0%	0%	0.3%	0%	0%
Escherichia coli	0%	0.01%	0.07%	0%	0%
Escherichia coli	0%	0.01%	0.07%	0%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%	0%
Klebsiella pneumoniae	0%	0.09%	0.27%	0%	0%
Klebsiella pneumoniae	0%	0.09%	0.27%	0%	0%
Klebsiella quasipneumoniae	0%	0.42%	0.79%	0%	0%
Klebsiella quasipneumoniae	0%	0.42%	0.79%	0%	0%
Providencia rettgeri	0%	0%	10.83%	0%	0%
Providencia rettgeri	0%	0%	10.83%	0%	0%
Salmonella enterica	0%	0.05%	0.01%	0%	0%
Salmonella enterica	0%	0.05%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AFQ31613.1|+|NDM-7 [Escherichia coli]
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVD
TAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMNALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR

>gb|JX262694.1|+|1-813|NDM-7 [Escherichia coli]
ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAA
ATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAG
CACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGGTGGTCGAT
ACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCAC
GCGCATCAGGACAAGATGGGCGGTATGAACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCG
CAAGAGGGGCTGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTC
AAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATC
AAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTC
CCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGC
TGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

NDM-7

Prevalence: protein homolog model (view sequences)

Graph