AAC(3)-Ia

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002528
Synonym(s)AAC(3)-Ia C aacC1 aacC-A1
CARD Short NameAAC(3)-Ia
DefinitionAAC(3)-Ia is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in S. marcescens, E. coli, Acinetobacter baumannii, Klebsiella pneumoniae, Klebsiella oxytoca, P. aeruginosa, Salmonella typhimurium and Proteus mirabilis.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter baumannii (13), Escherichia coli (5), Acinetobacter (2), Pseudomonas aeruginosa (2)
GAZAmes (6)
FOODON
ENVO
UBERON
Classification12 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic astromicin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-I
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs+gi, Brucella abortuswgs, Citrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep, Enterobacter hormaecheiwgs, Escherichia colig+wgs, Helicobacter pylorig, Klebsiella aerogenesg+gi, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Salmonella entericawgs, Serratia marcescensg+wgs
Publications

Wohlleben W, et al. 1989. Mol Gen Genet 217(2-3): 202-208. On the evolution of Tn21-like multiresistance transposons: sequence analysis of the gene (aacC1) for gentamicin acetyltransferase-3-I(AAC(3)-I), another member of the Tn21-based expression cassette. (PMID 2549372)

Javier Teran F, et al. 1991. J Antimicrob Chemother 28(3): 333-346. Characterization of two aminoglycoside-(3)-N-acetyltransferase genes and assay as epidemiological probes. (PMID 1960117)

Resistomes

Prevalence of AAC(3)-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii16.99%0%18.25%7.55%0%
Brucella abortus0%0%0.5%0%0%
Citrobacter freundii0%0.31%0.19%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0.56%0%0%0%
Enterobacter hormaechei0%0%0.35%0%0%
Escherichia coli0.05%0%0.01%0%0%
Helicobacter pylori0.77%0%0%0%0%
Klebsiella aerogenes4%0%0%25%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.03%0.14%0%0%
Klebsiella quasipneumoniae0%0.21%0.39%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0.92%0%0.33%0%0%
Pseudomonas aeruginosa0%0%1.35%0%0%
Pseudomonas monteilii0%0%2.38%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0%0%0.05%0%0%
Serratia marcescens1.52%0%1.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAG15269.1|+|AAC(3)-Ia [Pseudomonas aeruginosa]
MGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRSEIYIYDLAV
SGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPSTAT


>gb|U12338.3|+|5056-5520|AAC(3)-Ia [Pseudomonas aeruginosa]
ATGGGCATCATTCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGCGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGAC
GTAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCTGCCTTCGAC
CAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCCAGGTTTGAGCAGCCGCGTAGTGAGATCTATATCTATGATCTCGCAGTC
TCCGGCGAGCACCGGAGGCAGGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGGCCAACGCGCTTGGTGCTTATGTGATCTAC
GTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTGGGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCA
AGTACCGCCACCTAA

Curator Acknowledgements
Curator Description Most Recent Edit