AAC(3)-Id

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002529
Synonym(s)AAC(3)-Ie aacCA5
CARD Short NameAAC(3)-Id
DefinitionAAC(3)-Id is an aminoglycoside acetyltransferase encoded by genomic islands and integrons in S. enterica, P. mirabilis and Vibrio fluvialis.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (3), Salmonella (2)
GAZ
FOODON
ENVO
UBERON
Classification12 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic astromicin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-I
Resistomes with Perfect MatchesProteus mirabiliswgs, Salmonella entericag+p+wgs+gi
Resistomes with Sequence VariantsProteus mirabiliswgs, Pseudomonas aeruginosagi, Salmonella entericag+p+wgs+gi
Publications

Doublet B, et al. 2004. Antimicrob Agents Chemother 48(10): 3806-3812. Variant Salmonella genomic island 1 antibiotic resistance gene cluster containing a novel 3'-N-aminoglycoside acetyltransferase gene cassette, aac(3)-Id, in Salmonella enterica serovar newport. (PMID 15388438)

Levings RS, et al. 2005. Antimicrob Agents Chemother 49(3): 1238-1241. New integron-associated gene cassette encoding a 3-N-aminoglycoside acetyltransferase. (PMID 15728939)

Gionechetti F, et al. 2008. Microb Drug Resist 14(2): 93-99. Characterization of antimicrobial resistance and class 1 integrons in Enterobacteriaceae isolated from Mediterranean herring gulls (Larus cachinnans). (PMID 18476779)

Resistomes

Prevalence of AAC(3)-Id among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Proteus mirabilis0%0%0.17%0%0%
Pseudomonas aeruginosa0%0%0%5.56%0%
Salmonella enterica1.07%0.05%0.86%0.33%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAR21614.1|+|AAC(3)-Id [Salmonella enterica subsp. enterica serovar Newport]
MSVEIIHLTGNDVALLQSINAMFGEAFNDQDSYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKFEQQRSEIYIYDLAVA
ATRRREGIATALIKKLKAIGAARGAYVIYVQADKGVEDQPAIELYKKLGTIEDVFHFDIAVEQSKNHA


>gb|AY458224.1|+|707-1183|AAC(3)-Id [Salmonella enterica subsp. enterica serovar Newport]
GTGTCAGTCGAAATCATCCATCTCACTGGAAACGATGTTGCGTTGTTGCAGTCAATAAATGCCATGTTCGGCGAGGCATTCAACGACCAA
GATAGTTATGCCCGCAACAAGCCGTCATCAAGCTATCTTCAAAAACTGCTTAGCACTTCTAGTTTTATTGCGTTGGCTGCGGTTGACGAG
CAAAAAGTCATTGGCGCTATCGCCGCGTATGAGTTGCAAAAATTCGAGCAGCAAAGAAGCGAGATTTATATCTACGATCTCGCTGTAGCG
GCAACCCGCCGCAGAGAAGGCATAGCTACAGCTCTAATTAAAAAACTCAAGGCTATAGGCGCAGCGCGTGGAGCTTATGTGATTTACGTC
CAAGCTGATAAAGGCGTAGAAGACCAACCAGCCATAGAGCTCTATAAAAAACTAGGAACCATCGAAGACGTATTTCATTTCGACATTGCG
GTTGAGCAGAGTAAAAATCATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit