AAC(3)-Ic

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002531
Synonym(s)aacCA3
CARD Short NameAAC(3)-Ic
DefinitionAAC(3)-Ic is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic astromicin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ AAC(3)-I
Resistomes with Perfect MatchesEscherichia coliwgs, Pseudomonas aeruginosawgs, Serratia marcescenswgs
Resistomes with Sequence VariantsEscherichia coliwgs, Pseudomonas aeruginosawgs, Serratia marcescenswgs
Publications

Riccio ML, et al. 2003. Antimicrob Agents Chemother 47(5): 1746-1748. Novel 3-N-aminoglycoside acetyltransferase gene, aac(3)-Ic, from a Pseudomonas aeruginosa integron. (PMID 12709352)

Resistomes

Prevalence of AAC(3)-Ic among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli0%0%0.01%0%0%
Pseudomonas aeruginosa0%0%0.66%0%0%
Serratia marcescens0%0%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|CAD53575.1|+|AAC(3)-Ic [Pseudomonas aeruginosa]
MISTQTKITRLNSQDVGVMRAMLGMFGEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAALQGQEVIGGLAAYVLPKFEQQRKEIYIYDL
GVQGAYRRRGIATALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPAA


>gb|AJ511268.1|+|1295-1765|AAC(3)-Ic [Pseudomonas aeruginosa]
ATGATCTCTACTCAAACCAAGATTACCCGCCTCAACTCTCAAGACGTTGGTGTAATGCGGGCAATGCTAGGCATGTTCGGCGAGGCTTTT
GAGGACGCTGAGAACTATTGCCGCGCTCAACCAAGCGACAGTTACCTACAAGACTTACTGTGTGGCTCTGGCTTCATCGCAATCGCTGCG
TTACAGGGGCAAGAGGTCATCGGTGGGCTCGCCGCGTATGTGCTCCCAAAGTTTGAACAACAGCGCAAAGAAATCTATATCTACGACTTA
GGCGTGCAGGGAGCCTATCGCCGACGAGGCATCGCCACAGCCTTGATCAATGAACTCCAGCGTATCGCACATGATATTGGCGCTTATGTA
ATTTTTGTCCAGGCTGACTATGGGGACGATCCTGCGGTAGCGCTCTACACAAAACTCGGTATCCGGGAGGACGTGATGCACTTTGACATA
GAACCTCAACCTGCTGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit