AAC(6')-Ib

Accession ARO:3002546
Synonym(s)aacA4 AAC(6')-4
DefinitionAAC(6')-Ib is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in K. pneumoniae, P. mirabilis, P. aeruginosa, S. enterica, K. oxytoca, S. maltophilia, E. cloacae and V. cholerae
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEscherichia coliwgs, Klebsiella pneumoniaeg+p+wgs
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaeg+p+wgs, Pseudomonas aeruginosawgs
Classification19 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
Publications

Nobuta K, et al. 1988. J Bacteriol 170(8): 3769-3773. Sequencing and expression of the 6'-N-acetyltransferase gene of transposon Tn1331 from Klebsiella pneumoniae. (PMID 2841303)

Tran van Nhieu G, et al. 1987. J Bacteriol 169(12): 5708-5714. Primary structure of an aminoglycoside 6'-N-acetyltransferase AAC(6')-4, fused in vivo with the signal peptide of the Tn3-encoded beta-lactamase. (PMID 2824444)

Soler Bistue AJ, et al. 2006. Antimicrob Agents Chemother 50(5): 1903-1907. Vibrio cholerae InV117, a class 1 integron harboring aac(6')-Ib and blaCTX-M-2, is linked to transposition genes. (PMID 16641475)

Resistomes

Prevalence of AAC(6')-Ib among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Escherichia coli0%0%0.01%
Klebsiella pneumoniae1.2%0.5%1.97%
Pseudomonas aeruginosa0%0%0.02%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 350


>gb|AFJ11384.1|+|AAC(6')-Ib [Klebsiella pneumoniae]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFEKQGTVTTPDGPAVYMVQTRQAFERT
RSDA


>gb|JQ808129|+|634-1188|AAC(6')-Ib [Klebsiella pneumoniae]
GTGACCAACAGCAACGATTCCGTAACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAAGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA