AAC(6')-Ib

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002546
Synonym(s)AAC(6')-4 aacA4
CARD Short NameAAC(6')-Ib
DefinitionAAC(6')-Ib is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in K. pneumoniae, P. mirabilis, P. aeruginosa, S. enterica, K. oxytoca, S. maltophilia, E. cloacae and V. cholerae.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (25), Klebsiella pneumoniae (17), Pseudomonas aeruginosa (9), Acinetobacter baumannii (9), Enterobacteriaceae (5), Enterobacter cloacae (5), Serratia marcescens (5), Klebsiella (4), Enterobacter (2), Acinetobacter (2)
GAZAmes (14), China (3), Japan (3), Iran (2)
FOODONwater food product (4)
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-I
Resistomes with Perfect MatchesEscherichia coliwgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Pseudomonas aeruginosawgs, Vibrio choleraewgs
Resistomes with Sequence VariantsCitrobacter werkmaniiwgs, Escherichia coliwgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Pseudomonas aeruginosawgs, Vibrio choleraewgs
Publications

Nobuta K, et al. 1988. J Bacteriol 170(8): 3769-3773. Sequencing and expression of the 6'-N-acetyltransferase gene of transposon Tn1331 from Klebsiella pneumoniae. (PMID 2841303)

Tran van Nhieu G, et al. 1987. J Bacteriol 169(12): 5708-5714. Primary structure of an aminoglycoside 6'-N-acetyltransferase AAC(6')-4, fused in vivo with the signal peptide of the Tn3-encoded beta-lactamase. (PMID 2824444)

Soler Bistue AJ, et al. 2006. Antimicrob Agents Chemother 50(5): 1903-1907. Vibrio cholerae InV117, a class 1 integron harboring aac(6')-Ib and blaCTX-M-2, is linked to transposition genes. (PMID 16641475)

Resistomes

Prevalence of AAC(6')-Ib among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter werkmanii0%0%2.56%0%0%
Escherichia coli0%0%0.02%0%0%
Klebsiella pneumoniae0.53%0.82%2.86%0%0%
Klebsiella quasipneumoniae0%0%0.26%0%0%
Pseudomonas aeruginosa0%0%0.04%0%0%
Vibrio cholerae0%0%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AFJ11384.1|+|AAC(6')-Ib [Klebsiella pneumoniae]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFEKQGTVTTPDGPAVYMVQTRQAFERT
RSDA


>gb|JQ808129.1|+|634-1188|AAC(6')-Ib [Klebsiella pneumoniae]
GTGACCAACAGCAACGATTCCGTAACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAAGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit