AAC(6')-Ip

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002559
Synonym(s)aacA16
CARD Short NameAAC(6')-Ip
DefinitionAAC(6')-Ip is an aminoglycoside acetyltransferase encoded by plasmids and integrons in C. freundii, E. coli, E. faecium and Klebsiella aerogenes.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ AAC(6')-I
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs
Publications

Bunny KL, et al. 1995. Antimicrob Agents Chemother 39(3): 686-693. New mobile gene cassettes containing an aminoglycoside resistance gene, aacA7, and a chloramphenicol resistance gene, catB3, in an integron in pBWH301. (PMID 7793874)

Hannecart-Pokorni E, et al. 1997. Antimicrob Agents Chemother 41(2): 314-318. Characterization of the 6'-N-aminoglycoside acetyltransferase gene aac(6')-Im [corrected] associated with a sulI-type integron. (PMID 9021185)

Chow JW, et al. 2001. Antimicrob Agents Chemother 45(10): 2691-2694. Aminoglycoside resistance genes aph(2)-Ib and aac(6')-Im detected together in strains of both Escherichia coli and Enterococcus faecium. (PMID 11557456)

Resistomes

Prevalence of AAC(6')-Ip among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|CAA91010.1|+|AAC(6')-Ip [Citrobacter freundii]
MLKKSFLDAGNESWGDIKNAIEEVEECIEHPNICLGICLDDKLIGWTGLRPMYDKTWELHPMVIKTEYQGKGFGKVLLRELETRAKSRGI
IGIALGTDDEYQKTSLSMIDINERNIFDEIGNIKNVNNHPYEFYKKCGYMIVGIIPNANGKRKPDIWMWQILARKNSPTIAST


>gb|Z54241.1|+|530-1051|AAC(6')-Ip [Citrobacter freundii]
ATGCTTAAGAAAAGCTTTCTTGATGCTGGAAATGAATCATGGGGAGATATTAAAAATGCTATTGAAGAAGTTGAAGAATGTATAGAACAT
CCAAATATATGCTTGGGAATATGTCTGGATGATAAACTGATTGGATGGACCGGATTAAGGCCGATGTACGATAAGACCTGGGAACTTCAT
CCCATGGTTATAAAAACTGAATATCAAGGCAAGGGTTTTGGGAAAGTACTACTAAGAGAACTAGAGACGAGAGCGAAGAGTAGGGGAATT
ATCGGAATAGCTCTTGGAACTGATGACGAATATCAGAAAACTAGTTTGTCTATGATTGATATAAACGAACGAAATATCTTCGATGAAATC
GGGAATATAAAGAACGTTAATAATCATCCATATGAGTTTTATAAGAAATGTGGTTATATGATCGTTGGAATAATCCCTAATGCTAATGGA
AAAAGAAAACCAGATATATGGATGTGGCAGATATTAGCTAGGAAGAACAGCCCAACAATCGCTTCAACCTGA

Curator Acknowledgements
Curator Description Most Recent Edit