AAC(6')-Isa

Accession ARO:3002563
CARD Short NameAAC(6')-Isa
DefinitionAAC(6')-Isa is a plasmid-encoded aminoglycoside acetyltransferase in Streptomyces albulus.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ AAC(6')-I
Publications

Hamano Y, et al. 2004. J Biochem 136(4): 517-524. Overexpression and characterization of an aminoglycoside 6'-N-acetyltransferase with broad specificity from an epsilon-poly-L-lysine producer, Streptomyces albulus IFO14147. (PMID 15625322)

Resistomes

Prevalence of AAC(6')-Isa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|BAD10948.2|+|AAC(6')-Isa [Streptomyces albulus]
MELRGDDVVLRPVADGEGEVLDRIVREPEVAAWWSPPEDFAGMLAIVFEGEVVGAIQFYEETDPEFHHAGIDVFLTARHQGKGLGTDAVR
TLARWLVAERGHHRLTIDPAAANTAAIRSYRKVGFRPVGIMRAYGRDHRTGRWQDALLMDLLADELT


>gb|AB116646.1|+|430-903|AAC(6')-Isa [Streptomyces albulus]
ATGGAGCTGCGCGGGGACGACGTCGTACTGCGACCGGTGGCCGACGGCGAGGGCGAGGTGCTCGACCGGATCGTGCGGGAGCCGGAGGTG
GCGGCGTGGTGGTCGCCCCCGGAGGACTTCGCGGGCATGCTCGCCATCGTCTTCGAGGGCGAGGTCGTCGGAGCGATCCAGTTCTACGAG
GAGACCGACCCCGAATTCCACCACGCCGGCATCGACGTCTTCCTGACGGCACGCCACCAGGGGAAGGGGCTGGGCACCGACGCGGTGCGC
ACGCTGGCCCGGTGGCTGGTGGCGGAACGCGGCCACCACCGGCTGACCATCGACCCCGCCGCCGCCAACACCGCGGCGATCCGCAGCTAC
CGCAAGGTCGGGTTCCGGCCGGTGGGCATCATGCGGGCGTACGGGCGCGACCACCGGACGGGACGCTGGCAGGACGCGCTGCTCATGGAC
CTGCTCGCCGACGAACTGACCTGA

Curator Acknowledgements
Curator Description Most Recent Edit