AAC(6')-Ib3

Download Sequences

Accession	ARO:3002576
Synonym(s)	AAC(6')-Ib5 aacA4
CARD Short Name	AAC(6')-Ib3
Definition	AAC(6')-Ib3 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Citrobacter freundii^p+wgs, Enterobacter hormaechei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella pneumoniae^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Serratia marcescens^wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+wgs, Aeromonas caviae^wgs, Citrobacter freundii^p+wgs, Enterobacter asburiae^p, Enterobacter hormaechei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas putida^wgs, Serratia marcescens^wgs, Shigella sonnei^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + AAC(6') [AMR Gene Family]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic amikacin [Antibiotic] + confers_resistance_to_antibiotic kanamycin A [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + AAC(6')-I
Publications	Casin I, et al. 1998. Antimicrob Agents Chemother 42(2): 209-215. Aminoglycoside 6'-N-acetyltransferase variants of the Ib type with altered substrate profile in clinical isolates of Enterobacter cloacae and Citrobacter freundii. (PMID 9527761) Mabilat C, et al. 1992. Mol Gen Genet 235(1): 113-121. A new example of physical linkage between Tn1 and Tn21: the antibiotic multiple-resistance region of plasmid pCFF04 encoding extended-spectrum beta-lactamase TEM-3. (PMID 1331747)

Resistomes

Prevalence of AAC(6')-Ib3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0.18%	0%	0.22%	0%	0%
Acinetobacter baumannii	0.18%	0%	0.25%	0%	0%
Aeromonas caviae	0%	0%	0%	0%	0%
Aeromonas caviae	0%	0%	0.54%	0%	0%
Citrobacter freundii	0%	0.31%	0.19%	0%	0%
Citrobacter freundii	0%	0.31%	0.19%	0%	0%
Enterobacter asburiae	0%	0.28%	0%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0.17%	0%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%	0%
Escherichia coli	0%	0.01%	0.01%	0%	0%
Escherichia coli	0%	0.01%	0.01%	0%	0%
Klebsiella pneumoniae	0%	0%	0.06%	0%	0%
Klebsiella pneumoniae	0%	0.01%	0.15%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.19%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.11%	0%	0%
Pseudomonas putida	0%	0%	1.07%	0%	0%
Pseudomonas putida	0%	0%	0%	0%	0%
Serratia marcescens	0%	0%	0.92%	0%	0%
Serratia marcescens	0%	0%	0.92%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|ACS44715.1|+|AAC(6')-Ib3 [Acinetobacter baumannii]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSDA

>gb|FJ854362.1|+|1703-2257|AAC(6')-Ib3 [Acinetobacter baumannii]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATT
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(6')-Ib3

Prevalence: protein homolog model (view sequences)

Graph