AAC(6')-Ib3

Accession ARO:3002576
Synonym(s)AAC(6')-Ib5 aacA4
CARD Short NameAAC(6')-Ib3
DefinitionAAC(6')-Ib3 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Citrobacter freundiip, Enterobacter hormaecheiwgs, Escherichia colip, Klebsiella pneumoniaewgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Serratia marcescenswgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Aeromonas caviaewgs, Citrobacter freundiip, Enterobacter asburiaep, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Providencia rettgeriwgs, Pseudomonas aeruginosap+wgs, Pseudomonas putidawgs, Serratia marcescenswgs, Shigella sonneiwgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
Publications

Casin I, et al. 1998. Antimicrob Agents Chemother 42(2): 209-215. Aminoglycoside 6'-N-acetyltransferase variants of the Ib type with altered substrate profile in clinical isolates of Enterobacter cloacae and Citrobacter freundii. (PMID 9527761)

Mabilat C, et al. 1992. Mol Gen Genet 235(1): 113-121. A new example of physical linkage between Tn1 and Tn21: the antibiotic multiple-resistance region of plasmid pCFF04 encoding extended-spectrum beta-lactamase TEM-3. (PMID 1331747)

Resistomes

Prevalence of AAC(6')-Ib3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0.23%0%0.21%0%
Aeromonas caviae0%0%2.07%0%
Citrobacter freundii0%0.32%0%0%
Enterobacter asburiae0%0.91%0%0%
Enterobacter hormaechei0%0%0.41%0%
Escherichia coli0%0.01%0.01%0%
Klebsiella pneumoniae0%0.01%0.16%0%
Providencia rettgeri0%0%0.74%0%
Pseudomonas aeruginosa0%0.32%0.15%0%
Pseudomonas putida0%0%1.37%0%
Serratia marcescens0%0%0.97%0%
Shigella sonnei0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|ACS44715.1|+|AAC(6')-Ib3 [Acinetobacter baumannii]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSDA


>gb|FJ854362.1|+|1703-2257|AAC(6')-Ib3 [Acinetobacter baumannii]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATT
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA