AAC(6')-Ib4

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002577
CARD Short NameAAC(6')-Ib4
DefinitionAAC(6')-Ib4 is an aminoglycoside acetyltransferase in Serratia spp.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-I
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter lwoffiip, Acinetobacter pittiip+wgs, Alcaligenes faecaliswgs, Burkholderia cenocepaciawgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+p+wgs+gi, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Pseudomonas aeruginosap+wgs+gi, Pseudomonas monteiliiwgs, Serratia marcescensp+wgs, Stutzerimonas stutzerip+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter lwoffiip, Acinetobacter pittiip+wgs, Alcaligenes faecaliswgs, Burkholderia cenocepaciawgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+p+wgs+gi, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Pseudomonas aeruginosap+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidap, Serratia marcescensp+wgs, Stenotrophomonas maltophiliawgs, Stutzerimonas stutzerip+wgs
Publications

Toriya M, et al. 1992. Chem Pharm Bull (Tokyo) 40(9): 2473-2477. Nucleotide sequence of aminoglycoside 6'-N-acetyltransferase [AAC(6')] determinant from Serratia sp. 45. (PMID 1339319)

Resistomes

Prevalence of AAC(6')-Ib4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0.05%0.03%0%0%
Acinetobacter defluvii0%12.5%0%0%0%
Acinetobacter lwoffii0%1.39%0%0%0%
Acinetobacter pittii0%0.49%0.57%0%0%
Alcaligenes faecalis0%0%11.76%0%0%
Burkholderia cenocepacia0%0%4.39%0%0%
Citrobacter freundii0%0.62%2.71%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Enterobacter asburiae0%0%1.58%0%0%
Enterobacter cloacae0%0%4.15%0%0%
Enterobacter hormaechei0.36%0.71%2.63%3.33%0%
Enterobacter kobei0%1.38%1.31%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0%0.03%0.07%0%0%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella michiganensis0%1.71%2.39%0%0%
Klebsiella oxytoca0%0.68%0.42%0%0%
Klebsiella pneumoniae0%0.12%0.15%0%0%
Klebsiella quasipneumoniae0%0.64%0%0%0%
Pseudomonas aeruginosa0%2.63%1.92%4.17%0%
Pseudomonas monteilii0%0%9.52%0%0%
Pseudomonas putida0%4%0%0%0%
Serratia marcescens0%1.29%4.85%0%0%
Stenotrophomonas maltophilia0%0%0.15%0%0%
Stutzerimonas stutzeri0%9.09%3.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAL38577.1|+|AAC(6')-Ib4 [Acinetobacter baumannii]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSDA


>gb|AF445082.1|+|2789-3343|AAC(6')-Ib4 [Acinetobacter baumannii]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit