AAC(6')-Ib4

Download Sequences

Accession	ARO:3002577
CARD Short Name	AAC(6')-Ib4
Definition	AAC(6')-Ib4 is an aminoglycoside acetyltransferase in Serratia spp.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+p+wgs, Acinetobacter defluvii^p, Acinetobacter lwoffii^p, Acinetobacter pittii^p+wgs, Alcaligenes faecalis^wgs, Burkholderia cenocepacia^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^g+p+wgs+gi, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p, Pseudomonas aeruginosa^p+wgs+gi, Pseudomonas monteilii^wgs, Pseudomonas stutzeri^p+wgs, Serratia marcescens^p+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+p+wgs, Acinetobacter defluvii^p, Acinetobacter lwoffii^p, Acinetobacter pittii^p+wgs, Alcaligenes faecalis^wgs, Burkholderia cenocepacia^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^g+p+wgs+gi, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p, Pseudomonas aeruginosa^p+wgs+gi, Pseudomonas monteilii^wgs, Pseudomonas putida^p, Pseudomonas stutzeri^p+wgs, Serratia marcescens^p+wgs, Stenotrophomonas maltophilia^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + AAC(6') [AMR Gene Family]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic kanamycin A [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic amikacin [Antibiotic] + AAC(6')-I
Publications	Toriya M, et al. 1992. Chem Pharm Bull (Tokyo) 40(9): 2473-2477. Nucleotide sequence of aminoglycoside 6'-N-acetyltransferase [AAC(6')] determinant from Serratia sp. 45. (PMID 1339319)

Resistomes

Prevalence of AAC(6')-Ib4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0.18%	0.05%	0.03%	0%
Acinetobacter baumannii	0.18%	0.05%	0.03%	0%
Acinetobacter defluvii	0%	12.5%	0%	0%
Acinetobacter defluvii	0%	12.5%	0%	0%
Acinetobacter lwoffii	0%	1.39%	0%	0%
Acinetobacter lwoffii	0%	1.39%	0%	0%
Acinetobacter pittii	0%	0.49%	0.57%	0%
Acinetobacter pittii	0%	0.49%	0.57%	0%
Alcaligenes faecalis	0%	0%	11.76%	0%
Alcaligenes faecalis	0%	0%	11.76%	0%
Burkholderia cenocepacia	0%	0%	4.39%	0%
Burkholderia cenocepacia	0%	0%	4.39%	0%
Citrobacter freundii	0%	0.62%	1.55%	0%
Citrobacter freundii	0%	0.62%	1.55%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%
Enterobacter asburiae	0%	0%	0.79%	0%
Enterobacter asburiae	0%	0%	0.79%	0%
Enterobacter cloacae	0%	0%	1.6%	0%
Enterobacter cloacae	0%	0%	1.6%	0%
Enterobacter hormaechei	0.36%	0.71%	0.56%	3.33%
Enterobacter hormaechei	0.36%	0.71%	0.6%	3.33%
Enterobacter kobei	0%	1.38%	0.87%	0%
Enterobacter kobei	0%	1.38%	1.31%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Escherichia coli	0%	0.03%	0.03%	0%
Escherichia coli	0%	0.03%	0.03%	0%
Klebsiella aerogenes	0%	1.09%	0%	0%
Klebsiella aerogenes	0%	1.09%	0%	0%
Klebsiella michiganensis	0%	1.71%	1.6%	0%
Klebsiella michiganensis	0%	1.71%	1.6%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%
Klebsiella pneumoniae	0%	0.12%	0.12%	0%
Klebsiella pneumoniae	0%	0.12%	0.12%	0%
Klebsiella quasipneumoniae	0%	0.64%	0%	0%
Klebsiella quasipneumoniae	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	2.34%	1.18%	2.78%
Pseudomonas aeruginosa	0%	2.63%	1.21%	4.17%
Pseudomonas monteilii	0%	0%	4.76%	0%
Pseudomonas monteilii	0%	0%	4.76%	0%
Pseudomonas putida	0%	0%	0%	0%
Pseudomonas putida	0%	4%	0%	0%
Pseudomonas stutzeri	0%	9.09%	3.05%	0%
Pseudomonas stutzeri	0%	9.09%	3.05%	0%
Serratia marcescens	0%	1.29%	0.66%	0%
Serratia marcescens	0%	1.29%	0.66%	0%
Stenotrophomonas maltophilia	0%	0%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0.15%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|AAL38577.1|+|AAC(6')-Ib4 [Acinetobacter baumannii]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEE
ETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERT
RSDA

>gb|AF445082.1|+|2789-3343|AAC(6')-Ib4 [Acinetobacter baumannii]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

AAC(6')-Ib4

Prevalence: protein homolog model (view sequences)

Graph