AAC(6')-Ib7

Accession ARO:3002578
DefinitionAAC(6')-Ib7 is a plasmid-encoded aminoglycoside acetyltransferase in E. cloacae and C. freundii
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesSalmonella entericap
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella pneumoniaep+wgs, Morganella morganiig, Proteus mirabiliswgs, Providencia rettgerip, Pseudomonas aeruginosap+wgs, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella sonneip, Staphylococcus aureuswgs, Yersinia enterocoliticawgs
Classification19 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ AAC(6') [AMR Gene Family]
Publications

Casin I, et al. 1998. Antimicrob Agents Chemother 42(2): 209-215. Aminoglycoside 6'-N-acetyltransferase variants of the Ib type with altered substrate profile in clinical isolates of Enterobacter cloacae and Citrobacter freundii. (PMID 9527761)

Resistomes

Prevalence of AAC(6')-Ib7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0.71%0.14%
Citrobacter freundii0%0%0.64%
Enterobacter cloacae0%0%0.2%
Enterobacter hormaechei0%0%0.37%
Escherichia coli0.04%0.28%1.67%
Klebsiella aerogenes0%2%0.94%
Klebsiella pneumoniae0%0.52%3.32%
Morganella morganii5.88%0%0%
Proteus mirabilis0%0%1.12%
Providencia rettgeri0%20%0%
Pseudomonas aeruginosa0%3.85%0.42%
Salmonella enterica0%0.9%0.43%
Serratia marcescens0%0%0.18%
Shigella sonnei0%1.61%0%
Staphylococcus aureus0%0%0.05%
Yersinia enterocolitica0%0%1.27%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 475


>gb|AKN19287.1|-|AAC(6')-Ib7 [Salmonella enterica subsp. enterica serovar Corvallis]
MRSRNWSRTLTERSGGNGAVAVFMACYDCFFVQSMPRASKQQARYAVGRCLMLWSSNDVTQQGSRPKTKLGITKYSIVTNSNDSVTLRLM
TEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLL
ANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA


>gb|KR091911.1|-|74565-75350|AAC(6')-Ib7 [Salmonella enterica subsp. enterica serovar Corvallis]
ATGCGCTCACGCAACTGGTCCAGAACCTTGACCGAACGCAGCGGTGGTAACGGCGCAGTGGCGGTTTTCATGGCTTGTTATGACTGTTTT
TTTGTACAGTCTATGCCTCGGGCATCCAAGCAGCAAGCGCGTTACGCCGTGGGTCGATGTTTGATGTTATGGAGCAGCAACGATGTTACG
CAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATG
ACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTT
GCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGG
TATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTG
GCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAG
ATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCA
GATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA