AAC(6')-Ib8

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002579
CARD Short NameAAC(6')-Ib8
DefinitionAAC(6')-Ib8 is a plasmid-encoded aminoglycoside acetyltransferase in E. cloacae.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-I
Resistomes with Perfect MatchesCitrobacter portucalensiswgs, Enterobacter asburiaep+wgs, Enterobacter hormaecheiwgs, Klebsiella huaxiensisp
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaep+wgs, Aeromonas hydrophilap, Aeromonas veroniip, Citrobacter freundiip+wgs, Citrobacter portucalensisp+wgs, Enterobacter asburiaep+wgs, Enterobacter cloacaeg, Enterobacter hormaecheig+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia coliwgs, Klebsiella huaxiensisp, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Providencia rettgerig+wgs, Providencia stuartiip, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidawgs, Salmonella entericawgs, Serratia marcescenswgs, Vibrio parahaemolyticuswgs
Publications

Casin I, et al. 1998. Antimicrob Agents Chemother 42(2): 209-215. Aminoglycoside 6'-N-acetyltransferase variants of the Ib type with altered substrate profile in clinical isolates of Enterobacter cloacae and Citrobacter freundii. (PMID 9527761)

Resistomes

Prevalence of AAC(6')-Ib8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Aeromonas caviae0%9.09%29.03%0%0%
Aeromonas hydrophila0%3.9%0%0%0%
Aeromonas veronii0%3.08%0%0%0%
Citrobacter freundii0%0.31%1.35%0%0%
Citrobacter portucalensis0%5.88%2.7%0%0%
Enterobacter asburiae0%0.28%1.19%0%0%
Enterobacter cloacae1.79%0%0%0%0%
Enterobacter hormaechei0.36%0%2.37%0%0%
Enterobacter kobei0%0%0.44%0%0%
Enterobacter roggenkampii0%0.48%0.72%0%0%
Escherichia coli0%0%0.01%0%0%
Klebsiella huaxiensis0%7.69%0%0%0%
Klebsiella pneumoniae0%0.06%0.12%0%0%
Klebsiella quasipneumoniae0%1.06%0.26%0%0%
Proteus mirabilis0%0%0.66%0%0%
Providencia rettgeri5.88%0%0.64%0%0%
Providencia stuartii0%2.27%0%0%0%
Pseudomonas aeruginosa0.46%0.29%0.93%0%0%
Pseudomonas putida0%0%1.07%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0%0.26%0%0%
Vibrio parahaemolyticus0%0%0.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AIK02012.1|+|AAC(6')-Ib8 [Enterobacter cloacae]
MSLKPGPKRIAESTGQPDQRQRDNKKTPGNTDKLGITKYSIVTNSTDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQ
YLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPS
PSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA


>gb|KF998105.1|+|4172-4849|AAC(6')-Ib8 [Enterobacter cloacae]
ATGAGCCTTAAACCCGGACCAAAAAGAATTGCCGAATCGACGGGGCAACCTGATCAACGCCAACGCGACAATAAAAAGACGCCTGGAAAT
ACTGACAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCACCGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCG
ATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAG
TACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTT
GCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTG
GGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCG
CCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTAC
ATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit