AAC(6')-Ib9

Accession ARO:3002580
DefinitionAAC(6')-Ib9 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter haemolyticusp, Acinetobacter juniiwgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialiswgs, Citrobacter freundiip+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Proteus vulgariswgs, Providencia rettgeriwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap+wgs, Pseudomonas stutzeriwgs, Raoultella planticolap, Salmonella entericap+wgs, Serratia marcescensg+p+wgs, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs
Classification19 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ AAC(6') [AMR Gene Family]
Publications

Mugnier P, et al. 1998. Antimicrob Agents Chemother 42(12): 3113-3116. Novel OXA-10-derived extended-spectrum beta-lactamases selected in vivo or in vitro. (PMID 9835500)

Resistomes

Prevalence of AAC(6')-Ib9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii28.26%0.94%17.37%
Acinetobacter haemolyticus0%2.44%0%
Acinetobacter junii0%0%3.77%
Acinetobacter lwoffii0%0%5.26%
Acinetobacter nosocomialis0%0%1.1%
Citrobacter freundii0%3.77%7.64%
Enterobacter cloacae0%3.45%2.54%
Enterobacter hormaechei0%3.3%12.96%
Enterobacter kobei0%0%5.8%
Escherichia coli0.17%0.11%0.29%
Klebsiella aerogenes0%2%1.41%
Klebsiella oxytoca0%3.33%1.56%
Klebsiella pneumoniae0.4%0.82%5.03%
Morganella morganii0%0%1.79%
Proteus mirabilis0%0%1.12%
Proteus vulgaris0%0%10%
Providencia rettgeri0%0%3.12%
Pseudomonas aeruginosa0.77%13.46%3.64%
Pseudomonas putida0%10%3.12%
Pseudomonas stutzeri0%0%1.39%
Ralstonia mannitolilytica0%0%0%
Ralstonia pickettii0%0%0%
Raoultella planticola0%5.88%0%
Salmonella enterica0%0.09%0.18%
Serratia marcescens3.23%2.27%3.83%
Shigella sonnei0%0%0.08%
Stenotrophomonas maltophilia0%0%1.06%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|AAD02244.1|+|AAC(6')-Ib9 [Pseudomonas aeruginosa]
MLRSSSRPKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEP
IGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVT
TPDGPAVYMVQTRQAFERTRSDA


>gb|AF043381|+|252-863|AAC(6')-Ib9 [Pseudomonas aeruginosa]
ATGTTACGCAGCAGCAGTCGCCCTAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGC
CTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCG
ACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCG
ATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAG
TCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTC
ACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACC
ACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA