AAC(6')-Ib10

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002581
CARD Short NameAAC(6')-Ib10
DefinitionAAC(6')-Ib10 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-I
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter pittiiwgs, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+wgs, Aeromonas veroniig+p+wgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+p+wgs, Proteus mirabilisg+p+wgs, Providencia heimbachaep, Providencia rettgerig+wgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas monteiliiwgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Stutzerimonas stutzeriwgs, Vibrio choleraewgs, Vibrio vulnificuswgs
Publications

Mugnier P, et al. 1998. Microbiology 144(PT 4): 1021-1031. Carbapenems as inhibitors of OXA-13, a novel, integron-encoded beta-lactamase in Pseudomonas aeruginosa. (PMID 9579076)

Resistomes

Prevalence of AAC(6')-Ib10 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.06%0.42%1.14%1.26%0%
Acinetobacter pittii0%0%0.85%0%0%
Aeromonas caviae4.55%0%3.76%0%0%
Aeromonas hydrophila4.62%0%0.81%0%0%
Aeromonas veronii1.82%1.54%0.56%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0.31%2.71%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%4.5%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Enterobacter asburiae0%0.55%5.53%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae1.79%2.23%9.9%0%0%
Enterobacter hormaechei0.36%1.87%11.39%0%0%
Enterobacter kobei0%0.69%8.3%0%0%
Enterobacter roggenkampii0%0.48%9.71%0%0%
Escherichia coli0.05%0.26%0.88%0%0%
Escherichia fergusonii0%0%2.17%0%0%
Klebsiella aerogenes0%4.35%2.54%0%0%
Klebsiella michiganensis0%2.29%1.33%0%0%
Klebsiella oxytoca0%1.37%0.84%0%0%
Klebsiella pneumoniae1.12%3.45%16.95%0.95%0%
Klebsiella quasipneumoniae0%1.27%5.13%0%0%
Leclercia adecarboxylata0%0%34.88%0%0%
Morganella morganii1.92%10%3.07%0%0%
Proteus mirabilis1.83%6.25%2.97%0%0%
Providencia heimbachae0%100%0%0%0%
Providencia rettgeri2.94%0%2.55%0%0%
Providencia stuartii0%9.09%20.45%0%0%
Pseudomonas aeruginosa1.23%1.17%1.54%8.33%0%
Pseudomonas monteilii0%0%9.52%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0.06%0.22%0.07%0%0%
Serratia marcescens0%1.94%2.1%0%0%
Shigella flexneri0%0.8%0.47%0%0%
Stutzerimonas stutzeri0%0%1.53%0%0%
Vibrio cholerae0%0%0.19%0%0%
Vibrio vulnificus0%0%2.04%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAC46343.1|+|AAC(6')-Ib10 [Pseudomonas aeruginosa]
MLRSSSRPKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEP
IGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVT
TPDGPAVYMVQTRQAFERTRSDA


>gb|U59183.1|+|248-859|AAC(6')-Ib10 [Pseudomonas aeruginosa]
ATGTTACGCAGCAGCAGTCGCCCTAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGC
CTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCG
ACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCG
ATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAG
TTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTC
ACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACC
ACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit