AAC(6')-Ib10

Accession ARO:3002581
DefinitionAAC(6')-Ib10 is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Citrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterococcus faeciumwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Proteus mirabilisg+p+wgs, Providencia rettgerig+wgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas stutzeriwgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella flexneriwgs, Vibrio choleraewgs
Classification19 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ AAC(6') [AMR Gene Family]
Publications

Mugnier P, et al. 1998. Microbiology 144(PT 4): 1021-1031. Carbapenems as inhibitors of OXA-13, a novel, integron-encoded beta-lactamase in Pseudomonas aeruginosa. (PMID 9579076)

Resistomes

Prevalence of AAC(6')-Ib10 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii2.17%0.24%1.04%
Citrobacter freundii0%1.89%2.55%
Enterobacter asburiae0%0%8.33%
Enterobacter cloacae0%4.6%8.4%
Enterobacter hormaechei1.61%4.4%8.44%
Enterobacter kobei0%0%13.04%
Enterococcus faecium0%0%0.06%
Escherichia coli0%0.18%0.5%
Klebsiella aerogenes0%4%4.23%
Klebsiella oxytoca0%0%1.95%
Klebsiella pneumoniae1.8%3.03%20.8%
Proteus mirabilis2.38%2.78%2.23%
Providencia rettgeri12.5%0%12.5%
Providencia stuartii0%5.88%8.33%
Pseudomonas aeruginosa1.53%7.69%1.21%
Pseudomonas stutzeri0%0%2.78%
Salmonella enterica0%0.36%0.06%
Serratia marcescens0%1.14%2.91%
Shigella flexneri0%0%0.5%
Vibrio cholerae0%0%0.16%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|AAC46343.1|+|AAC(6')-Ib10 [Pseudomonas aeruginosa]
MLRSSSRPKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEP
IGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVT
TPDGPAVYMVQTRQAFERTRSDA


>gb|U59183|+|248-859|AAC(6')-Ib10 [Pseudomonas aeruginosa]
ATGTTACGCAGCAGCAGTCGCCCTAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGC
CTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCG
ACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCG
ATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAG
TTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTC
ACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACC
ACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA