AAC(3)-Ib/AAC(6')-Ib''

Accession ARO:3002600
DefinitionAAC(3)-Ib/AAC(6')-Ib'' is an integron-encoded aminoglycoside acetyltransferase in P. aeruginosa
AMR Gene FamilyAAC(3), AAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsEnterobacter asburiaewgs, Enterobacter kobeiwgs, Escherichia coliwgs, Pseudomonas aeruginosawgs
Classification20 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(3) [AMR Gene Family]
+ AAC(6') [AMR Gene Family]
Publications

Dubois V, et al. 2002. Antimicrob Agents Chemother 46(3): 638-645. Molecular characterization of a novel class 1 integron containing bla(GES-1) and a fused product of aac3-Ib/aac6'-Ib' gene cassettes in Pseudomonas aeruginosa. (PMID 11850242)

Resistomes

Prevalence of AAC(3)-Ib/AAC(6')-Ib'' among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter asburiae0%0%1.19%
Enterobacter kobei0%0%1.45%
Escherichia coli0%0%0.01%
Pseudomonas aeruginosa0%0%0.02%
Show Perfect Only

Prevalence: protein domain meta-model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|AAL82588.1|+|AAC(3)-Ib/AAC(6')-Ib'' [Pseudomonas aeruginosa]
MSIIATVKIGPDEISAMRAVLDLFGKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYIYDLAV
ASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPLTNSNDSVTLRLMTEHDLAMLYEWVNRSHI
VEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGGGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRA
LVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA


>gb|AF355189|+|1435-2439|AAC(3)-Ib/AAC(6')-Ib'' [Pseudomonas aeruginosa]
ATGAGCATCATTGCAACCGTCAAGATCGGCCCTGACGAAATTTCAGCCATGAGGGCTGTGCTCGATCTCTTCGGCAAAGAGTTTGAGGAC
ATTCCAACCTACTCTGATCGCCAGCCGACCAATGAGTATCTTGCCAATCTTCTGCACAGCGAGACGTTCATCGCGCTCGCTGCTTTTGAC
CGCGGAACAGCAATAGGTGGGCTCGCAGCCTACGTTCTACCCAAGTTCGAGCAAGCGCGAAGCGAGATCTACATTTATGACTTGGCAGTC
GCTTCCAGCCATCGAAGGCTAGGAGTCGCAACTGCCCTGATTAGCCACCTGAAGCGTGTGGCGGTTGAACTTGGCGCGTATGTAATCTAT
GTGCAAGCAGACTACGGTGACGATCCGGCAGTCGCTCTCTACACAAAGCTTGGAGTTCGGGAAGACGTCATGCACTTCGACATTGATCCA
TTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGGTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAGGCGGGGACGGATGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTCACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA


Model Name: AAC(3)-Ib/AAC(6')-Ib''

Model Description: fusion protein composed of AAC(3)-Ib and AAC(6')-Ib'

AAC(3)-Ib AAC(6')-Ib