APH(3')-IIb

Accession ARO:3002645
Synonym(s)APH(3')-IIps
DefinitionAPH(3')-IIb is a chromosomal-encoded aminoglycoside phosphotransferase in P. aeruginosa
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs
Resistomes with Sequence VariantsPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg, Stenotrophomonas maltophiliawgs, Vibrio vulnificuswgs
Classification11 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic butirosin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3') [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
Publications

Stover CK, et al. 2000. Nature 406(6799): 959-964. Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen. (PMID 10984043)

Zeng L, et al. 2003. Antimicrob. Agents Chemother. 47(12):3867-76 aph(3')-IIb, a gene encoding an aminoglycoside-modifying enzyme, is under the positive control of surrogate regulator HpaA. (PMID 14638496)

Resistomes

Prevalence of APH(3')-IIb among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%0%
Pseudomonas aeruginosa97.7%0%98.76%
Pseudomonas fluorescens3.85%0%0%
Stenotrophomonas maltophilia0%0%0.53%
Vibrio vulnificus0%0%0.62%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAA62365.1|+|APH(3')-IIb [Pseudomonas aeruginosa]
MHDAATSMPPQAPSTWADYLAGYRWRGQGEGCSAATVHRLEAARRPTLFVKQEVLSAHAELPAEIARLRWLHGAGIDCPQVLNETQSDGR
QWLLMSAMPGDTLSALAQRDELEPERLVRLVAAALRRLHDLDPAACPFDHRLERRLDTVRQRVEAGLVDEADFDDDHRGRSATELYRLLL
DRRPAVEDLVVAHGDACLPNLLAEGRRFSGFIDCGRLGVADRHQDLALAARDIEAELGAAWAEAFLVEYGGDIDGERLAYFRLLDEFF


>gb|X90856|+|388-1194|APH(3')-IIb [Pseudomonas aeruginosa]
ATGCATGATGCAGCCACCTCCATGCCGCCGCAGGCTCCCTCAACCTGGGCCGACTACCTTGCCGGCTACCGCTGGCGAGGGCAGGGCGAA
GGATGTTCCGCGGCCACGGTCCACCGCCTGGAGGCTGCGCGGCGGCCGACCCTGTTCGTCAAGCAGGAAGTGCTGTCCGCACATGCCGAG
CTGCCCGCCGAAATCGCCCGCCTGCGCTGGCTGCACGGTGCCGGCATCGACTGCCCGCAGGTGCTGAACGAAACCCAGAGCGACGGCCGG
CAATGGCTGCTGATGAGCGCAATGCCGGGGGACACGCTGTCCGCGCTGGCGCAGCGCGACGAGCTGGAGCCCGAGCGCCTGGTGCGCCTG
GTGGCCGCCGCCCTGCGCCGGCTGCACGATCTCGATCCGGCCGCCTGTCCCTTCGATCATCGCCTGGAACGGCGTCTGGACACCGTGCGC
CAGCGGGTCGAGGCCGGGCTGGTGGACGAGGCGGACTTCGACGACGACCATCGCGGTCGCAGCGCCACGGAGCTGTACCGCCTGCTGCTC
GACCGGCGTCCGGCGGTCGAAGACCTGGTGGTCGCCCACGGCGACGCCTGCCTGCCCAACCTCTTGGCGGAGGGCCGGCGCTTCAGCGGC
TTCATCGATTGCGGGCGGCTCGGCGTCGCCGACCGGCACCAGGACCTGGCCCTGGCCGCGCGGGACATCGAGGCCGAACTCGGCGCGGCC
TGGGCCGAGGCCTTCCTCGTCGAATACGGCGGCGATATCGACGGCGAACGGCTGGCGTACTTCAGGCTATTGGACGAGTTCTTCTAG