rmtD

Accession ARO:3002667
CARD Short NamermtD
DefinitionRmtD is a 16S rRNA methyltransferase found in Pseudomonas aeruginosa which methylates G1405 of the 16S rRNA. It confers high level resistance to many aminoglycosides.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesKlebsiella pneumoniaewgs, Klebsiella quasipneumoniaeg+p, Pseudomonas aeruginosag+wgs
Resistomes with Sequence VariantsBurkholderia cenocepaciawgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaeg+p, Pseudomonas aeruginosag+wgs+gi
Classification12 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
Publications

Yamane K, et al. 2008. J Antimicrob Chemother 61(3): 746-747. 16S ribosomal RNA methylase RmtD produced by Klebsiella pneumoniae in Brazil. (PMID 18222955)

Doi Y, et al. 2007. Antimicrob. Agents Chemother. 51(3):852-6 Coproduction of novel 16S rRNA methylase RmtD and metallo-beta-lactamase SPM-1 in a panresistant Pseudomonas aeruginosa isolate from Brazil. (PMID 17158944)

Resistomes

Prevalence of rmtD among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Burkholderia cenocepacia0%0%0.88%0%
Escherichia coli0%0%0%0%
Klebsiella pneumoniae0%0%0.03%0%
Klebsiella quasipneumoniae0.84%0.21%0%0%
Pseudomonas aeruginosa0.77%0%0.51%1.39%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|ABY64751.1|-|rmtD [Klebsiella pneumoniae]
MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDVDKAAREALHGVTGAFMTEREYKRAMEMAAARDWEALLGMHASTRERLPVES
MDRVFDQLFEASGTPARILDLACGLNPVYLAHRLPNAAITGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEANAALLFKVLPLLERQR
AGAAMDALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK


>gb|EU269034.2|-|1480-2223|rmtD [Klebsiella pneumoniae]
ATGAGCGAACTGAAGGAAAAACTGCTCGCTTCGAAAAAATATCGCGACGTTTGCCCGGACACGATCGAGCGCATATGGCGTGAATGCAGC
GCGAAATTCAAAAAGGAAAAGGACGTGGACAAGGCGGCGCGCGAAGCGCTTCACGGCGTGACCGGCGCGTTCATGACCGAGCGCGAATAC
AAACGCGCAATGGAAATGGCGGCGGCACGCGATTGGGAAGCGCTGCTTGGAATGCACGCGTCCACGCGCGAACGGCTGCCTGTGGAATCG
ATGGATCGCGTGTTCGATCAGCTGTTTGAAGCCAGCGGAACGCCGGCGCGAATCCTCGATCTCGCGTGCGGGCTGAATCCTGTCTACCTC
GCGCATCGATTGCCAAATGCGGCGATTACCGGCGTGGATATCAGCGGTCAGTGCGTAAACGTAATTCGTGCGTTTGGCGGCGCGGAAGCG
CGTTTGGGCGATTTGCTGTGCGAAATCCCGGAAGACGAGGCGAATGCGGCGCTGCTGTTTAAGGTGCTGCCGCTTTTGGAGCGCCAGCGT
GCGGGCGCGGCGATGGATGCGCTAATGCGCGTGAATGCGGAATGGATCGTCGCATCGTTTCCGACGCGTTCGCTCGGCGGGCGCAACGTC
GGCATGGAAAAGCACTATTCCGAATGGATGGAGGCGCACGTGCCGGAAAATCGCGCGATTGCCGCGCGGCTGACCGGCGAAAACGAGCTG
TTTTACGTGCTGAAACGAAAATGA