rmtG

Download Sequences

Accession	ARO:3002668
CARD Short Name	rmtG
Definition	RmtG is a 16S rRNA methyltransferase found in Pseudomonas aeruginosa which methylates G1405 of the 16S rRNA. It confers high level resistance to many aminoglycosides.
AMR Gene Family	16S rRNA methyltransferase (G1405)
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Klebsiella aerogenes^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^wgs
Resistomes with Sequence Variants	Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Klebsiella aerogenes^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target alteration [Resistance Mechanism] + antibiotic target modifying enzyme + ribosomal alteration conferring antibiotic resistance + antibiotic molecule + antibiotic mixture + rRNA methyltransferase conferring antibiotic resistance + aminoglycoside antibiotic [Drug Class] + gentamicin [Antibiotic] + 16S ribosomal RNA methyltransferase
Parent Term(s)	5 ontology terms \| Show + confers_resistance_to_antibiotic amikacin [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic arbekacin [Antibiotic] + confers_resistance_to_antibiotic gentamicin A [Antibiotic] + 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications	Bueno MF, et al. 2013. Antimicrob Agents Chemother 57(5): 2397-2400. Coproduction of 16S rRNA methyltransferase RmtD or RmtG with KPC-2 and CTX-M group extended-spectrum beta-lactamases in Klebsiella pneumoniae. (PMID 23459483)

Resistomes

Prevalence of rmtG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter hormaechei	0%	0%	0.26%	0%	0%
Enterobacter hormaechei	0%	0%	0.26%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Escherichia coli	0%	0%	0%	0%	0%
Escherichia coli	0%	0%	0%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella pneumoniae	0%	0.06%	0.06%	0%	0%
Klebsiella pneumoniae	0%	0.07%	0.06%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450

Protein
DNA

>gb|AGE00988.1|+|rmtG [Klebsiella pneumoniae]
MRDPLFEKLAASKKYRDVCPDTIARILTECRAKYRREKEIDKAAREKLHGITAAFMTDAEYRRAMEIAVRGGELAELMECHASTRERLPL
EETDAVYARLLGAPDESALDLACGLNPAYLQNRYPEMRVTGIDISGQCVRVLRALGVDARLGDLLAENAIPRARYSVALLFKILPLLDRQ
SAGAARRILEAVNADALICSFPTRSLSGRNVGMAVHYAAWMRDQLPEKWRIERTVETDNELYYVLKEKQDGEAVRGGDSHRESE

>gb|JX486113.1|+|1-795|rmtG [Klebsiella pneumoniae]
ATGCGTGATCCGTTGTTTGAAAAGCTGGCGGCTTCGAAGAAATACCGCGATGTGTGTCCGGATACGATCGCGCGCATTTTAACGGAATGC
CGCGCGAAGTACCGGCGGGAAAAGGAAATCGATAAAGCGGCGCGCGAAAAGCTGCACGGCATCACCGCTGCGTTCATGACGGATGCGGAA
TACAGGCGCGCGATGGAAATTGCAGTGCGGGGCGGCGAACTGGCTGAATTGATGGAATGCCACGCCTCCACGCGCGAACGGCTGCCGCTG
GAAGAAACAGATGCCGTGTATGCGCGTCTGTTGGGTGCGCCCGACGAATCGGCGCTGGATCTGGCGTGCGGGCTGAATCCCGCGTATCTG
CAAAATCGATACCCCGAAATGCGCGTTACCGGAATCGATATCAGCGGCCAATGCGTGCGCGTGCTGCGCGCGCTGGGCGTGGATGCGCGC
CTCGGCGATCTGCTTGCGGAGAACGCGATTCCGCGGGCGCGGTATTCCGTCGCGCTGCTGTTTAAAATTCTGCCGCTGCTGGATCGCCAG
TCGGCGGGCGCGGCGCGGCGCATCCTGGAAGCGGTGAACGCCGATGCGCTGATCTGTTCGTTCCCCACGCGCAGCCTGTCCGGCAGAAAT
GTGGGCATGGCGGTGCATTACGCCGCGTGGATGCGGGATCAGCTGCCCGAAAAATGGCGAATCGAACGCACCGTGGAAACGGATAACGAG
CTATATTACGTTCTGAAGGAGAAACAGGATGGCGAAGCTGTACGTGGTGGCGACTCCCATCGGGAATCTGAATGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

rmtG

Prevalence: protein homolog model (view sequences)

Graph