rmtG

Accession ARO:3002668
CARD Short NamermtG
DefinitionRmtG is a 16S rRNA methyltransferase found in Pseudomonas aeruginosa which methylates G1405 of the 16S rRNA. It confers high level resistance to many aminoglycosides.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesEnterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs
Resistomes with Sequence VariantsEnterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs
Classification10 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications

Bueno MF, et al. 2013. Antimicrob Agents Chemother 57(5): 2397-2400. Coproduction of 16S rRNA methyltransferase RmtD or RmtG with KPC-2 and CTX-M group extended-spectrum beta-lactamases in Klebsiella pneumoniae. (PMID 23459483)

Resistomes

Prevalence of rmtG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter cloacae0%0%0.36%0%
Enterobacter hormaechei0%0%0.28%0%
Enterobacter kobei0%0%0.52%0%
Escherichia coli0%0%0%0%
Klebsiella aerogenes0%0%0.31%0%
Klebsiella pneumoniae0%0.08%0.08%0%
Klebsiella quasipneumoniae0%0%0.16%0%
Providencia stuartii0%0%2.27%0%
Pseudomonas aeruginosa0%0%0.02%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|AGE00988.1|+|rmtG [Klebsiella pneumoniae]
MRDPLFEKLAASKKYRDVCPDTIARILTECRAKYRREKEIDKAAREKLHGITAAFMTDAEYRRAMEIAVRGGELAELMECHASTRERLPL
EETDAVYARLLGAPDESALDLACGLNPAYLQNRYPEMRVTGIDISGQCVRVLRALGVDARLGDLLAENAIPRARYSVALLFKILPLLDRQ
SAGAARRILEAVNADALICSFPTRSLSGRNVGMAVHYAAWMRDQLPEKWRIERTVETDNELYYVLKEKQDGEAVRGGDSHRESE


>gb|JX486113.1|+|1-795|rmtG [Klebsiella pneumoniae]
ATGCGTGATCCGTTGTTTGAAAAGCTGGCGGCTTCGAAGAAATACCGCGATGTGTGTCCGGATACGATCGCGCGCATTTTAACGGAATGC
CGCGCGAAGTACCGGCGGGAAAAGGAAATCGATAAAGCGGCGCGCGAAAAGCTGCACGGCATCACCGCTGCGTTCATGACGGATGCGGAA
TACAGGCGCGCGATGGAAATTGCAGTGCGGGGCGGCGAACTGGCTGAATTGATGGAATGCCACGCCTCCACGCGCGAACGGCTGCCGCTG
GAAGAAACAGATGCCGTGTATGCGCGTCTGTTGGGTGCGCCCGACGAATCGGCGCTGGATCTGGCGTGCGGGCTGAATCCCGCGTATCTG
CAAAATCGATACCCCGAAATGCGCGTTACCGGAATCGATATCAGCGGCCAATGCGTGCGCGTGCTGCGCGCGCTGGGCGTGGATGCGCGC
CTCGGCGATCTGCTTGCGGAGAACGCGATTCCGCGGGCGCGGTATTCCGTCGCGCTGCTGTTTAAAATTCTGCCGCTGCTGGATCGCCAG
TCGGCGGGCGCGGCGCGGCGCATCCTGGAAGCGGTGAACGCCGATGCGCTGATCTGTTCGTTCCCCACGCGCAGCCTGTCCGGCAGAAAT
GTGGGCATGGCGGTGCATTACGCCGCGTGGATGCGGGATCAGCTGCCCGAAAAATGGCGAATCGAACGCACCGTGGAAACGGATAACGAG
CTATATTACGTTCTGAAGGAGAAACAGGATGGCGAAGCTGTACGTGGTGGCGACTCCCATCGGGAATCTGAATGA