msrC

Accession ARO:3002819
Synonym(s)msr(C)
DefinitionmsrC is a chromosomal-encoded ABC-F subfamily protein expressed in Enterococcus faecium that confers resistance to erythromycin and other macrolide and streptogramin B antibiotics.
AMR Gene FamilyABC-F ATP-binding cassette ribosomal protection protein
Drug Classmacrolide antibiotic, phenicol antibiotic, pleuromutilin antibiotic, lincosamide antibiotic, oxazolidinone antibiotic, streptogramin antibiotic, tetracycline antibiotic
Resistance Mechanismantibiotic target protection
ResistomesEnterococcus faeciumg+wgs
Classification16 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_drug_class macrolide antibiotic [Drug Class]
+ confers_resistance_to_drug_class streptogramin antibiotic [Drug Class]
+ msr-type ABC-F protein
Publications

Singh KV, et al. 2001. Antimicrob Agents Chemother 45(1): 263-266. Disruption of an Enterococcus faecium species-specific gene, a homologue of acquired macrolide resistance genes of staphylococci, is associated with an increase in macrolide susceptibility. (PMID 11120975)

Resistomes

Prevalence of msrC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecium68%0%60.42%
Klebsiella oxytoca0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 950


>gb|AAK01167.1|+|msrC [Enterococcus faecium]
MENLAVNITNLQVRFGNQLELSIDSLRVYQQDRIGIIGENGVGKTTLLKLIVGELIPNQGKIQTEITFNYLPQLTYLAEAKDLNLELASH
FQLKLEETSERKWSGGEERKIELIRLLSSYEQGMLLDEPTTHLDRKSMDRLIEELRYYYGTLIFVSHDRYFLDELATKVWEVKDGEIREF
PENYSAYLTQRELEKKTQLREAESIMKEKKRLEKSIQEKKKQAEKLEKVSSKKKKQQIRPDRLSSSKQKDSVQKAIQKNTKTLERRLQKI
GETTKPQQMKQIRFPVPKSLELHNRYPIMGQNIQLERSGRTLLINSDFQFSLGKKIAIVGENGSGKTTLLEHIRKQGEGILLSPKVSFQV
YQQKDYQMTSEESVIRFVMRQTEFSESLVRSLLNHLGFAQETLTKPLCTLSGGEATRLTIALLFTKPSNVLLLDEPTNFIDVATIEALEQ
LMQVYPGTILFTSHDSYFVERTADEVYEIKGQKIKKVLTRNF


>gb|AF313494|+|1-1479|msrC [Enterococcus faecium]
ATGGAAAATTTAGCAGTAAATATAACAAACCTGCAAGTTCGTTTTGGTAACCAGTTAGAATTATCTATTGATTCTCTTCGTGTCTATCAG
CAAGATCGGATAGGAATCATAGGGGAAAATGGAGTCGGTAAAACAACGTTGCTGAAACTGATAGTCGGTGAACTTATCCCCAATCAAGGG
AAAATCCAAACAGAGATCACTTTCAACTATCTGCCTCAATTAACCTATCTTGCTGAGGCAAAGGACCTAAATTTGGAATTAGCCAGTCAT
TTCCAGTTGAAACTGGAAGAAACTTCGGAACGGAAATGGAGTGGAGGGGAAGAACGAAAGATCGAGTTGATACGTCTTCTTTCTTCTTAT
GAACAAGGGATGCTTCTAGACGAGCCGACAACCCATCTAGATAGAAAAAGTATGGATCGACTAATTGAAGAGCTTCGTTATTATTATGGC
ACGCTGATTTTTGTTAGTCATGACCGCTATTTTCTAGATGAGTTGGCAACGAAAGTCTGGGAAGTAAAAGACGGAGAAATCCGAGAGTTT
CCGGAGAATTATAGTGCCTATCTCACTCAAAGGGAATTGGAGAAAAAGACTCAGCTACGAGAAGCAGAGTCGATCATGAAAGAGAAAAAA
CGATTGGAAAAATCGATCCAAGAAAAGAAAAAACAAGCGGAAAAGTTAGAAAAAGTGTCCAGTAAAAAGAAAAAGCAACAAATCAGACCG
GATCGGTTGTCTTCCTCTAAACAAAAAGACAGTGTACAAAAAGCCATCCAAAAGAATACGAAAACATTAGAGAGAAGACTCCAAAAAATA
GGAGAAACAACCAAACCGCAACAGATGAAACAAATCCGTTTTCCAGTACCAAAATCTCTTGAACTCCACAATCGTTATCCAATCATGGGA
CAAAATATCCAATTGGAAAGAAGCGGAAGAACATTACTGATAAATAGCGATTTTCAATTTTCTTTAGGTAAAAAAATCGCGATTGTCGGC
GAAAATGGATCAGGTAAGACAACTTTATTGGAACATATCCGCAAACAAGGAGAAGGAATCCTTCTCTCTCCGAAAGTAAGCTTTCAAGTA
TATCAGCAAAAGGATTATCAAATGACATCTGAAGAATCCGTCATTCGTTTTGTCATGAGACAAACAGAGTTTTCGGAATCACTTGTCCGC
AGTTTGTTGAATCATTTAGGGTTTGCTCAGGAAACTCTGACGAAACCGTTGTGTACGTTAAGTGGGGGAGAAGCGACTCGTTTGACGATT
GCTTTGCTTTTTACTAAGCCAAGTAATGTGTTGCTGTTAGATGAACCGACTAATTTCATTGATGTGGCAACGATCGAAGCTTTAGAGCAG
CTGATGCAAGTATATCCGGGAACGATTTTGTTTACTTCACATGATTCCTACTTTGTCGAGCGTACGGCTGATGAAGTTTATGAAATAAAA
GGGCAGAAAATAAAAAAAGTACTTACGAGAAATTTTTAA