vanR gene in vanM cluster

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002928
Synonym(s)vanR-M vanRM
CARD Short NamevanR_in_vanM_cl
DefinitionAlso known as vanRM, is a vanR variant found in the vanM gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanR
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Classification16 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ part_of glycopeptide resistance gene cluster VanM
+ vanR [AMR Gene Family]
Resistomes with Perfect MatchesEnterococcus faeciump+wgs, Klebsiella pneumoniaewgs
Resistomes with Sequence VariantsEnterococcus faeciump+wgs, Klebsiella pneumoniaewgs
Publications

Xu X, et al. 2010. Antimicrob Agents Chemother 54(11): 4643-4647. vanM, a new glycopeptide resistance gene cluster found in Enterococcus faecium. (PMID 20733041)

Resistomes

Prevalence of vanR gene in vanM cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus faecium0%0.19%0.17%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ACL82957.1|+|vanR gene in vanM cluster [Enterococcus faecium]
MRRISILIAEDEEEIADLLAIHLEKEGYDVIKVHDGQEALHVIQAQSIDLIILDIMMPKMDGYEVTRQVRAQYNMPIIFLSAKTSDFDKV
HGLVIGGDDYITKPFTPIELVARVNAQLRRSMKLNHPQADDKKSILEFGEIVISPDQRTVFLYGENIGLTPKEFDILYLLASHPKKVYSV
ENIFQQVWNDAYFGGGNTVMVHIRTLRKKLGEDKRKNKLIKTVWGVGYTFNG


>gb|FJ349556.1|+|982-1680|vanR gene in vanM cluster [Enterococcus faecium]
ATGAGACGTATATCGATTTTAATTGCTGAAGATGAAGAAGAAATTGCTGATTTGCTTGCCATTCACCTGGAAAAAGAAGGATATGACGTT
ATTAAAGTACATGACGGACAAGAAGCCCTCCATGTAATCCAGGCTCAATCAATTGATTTGATAATTTTAGATATTATGATGCCGAAAATG
GATGGATATGAAGTAACCCGTCAAGTCCGTGCACAGTATAATATGCCAATCATTTTTTTAAGTGCGAAAACTTCTGATTTCGATAAGGTG
CATGGTCTAGTGATTGGAGGGGATGATTATATAACAAAGCCATTTACCCCGATTGAATTGGTTGCTCGTGTGAACGCTCAATTGCGGCGC
TCTATGAAGTTGAATCACCCCCAAGCAGATGATAAAAAATCTATCTTGGAGTTCGGTGAGATCGTGATTTCTCCTGATCAACGTACAGTT
TTTCTTTATGGTGAAAACATCGGGTTAACGCCGAAAGAGTTTGATATTTTGTATTTATTAGCCAGTCATCCAAAGAAAGTTTATAGTGTC
GAAAATATTTTCCAGCAAGTTTGGAATGATGCATACTTTGGAGGCGGTAATACGGTAATGGTGCATATTCGCACCTTGCGGAAAAAACTT
GGAGAAGATAAGCGAAAAAATAAGTTAATCAAAACTGTGTGGGGAGTGGGGTATACGTTCAATGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit