smeE

Accession ARO:3003056
DefinitionsmeE is the RND protein of the efflux complex smeDEF in Stenotrophomonas maltophilia
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classphenicol antibiotic, tetracycline antibiotic, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Zhang L, et al. 2001. Antimicrob Agents Chemother 45(12): 3497-3503. SmeDEF multidrug efflux pump contributes to intrinsic multidrug resistance in Stenotrophomonas maltophilia. (PMID 11709330)

Resistomes

Prevalence of smeE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Proteus mirabilis0%0%0.86%
Stenotrophomonas maltophilia95.83%0%93.75%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 2070


>gb|CAC14595.1|+|smeE [Stenotrophomonas maltophilia]
MARFFIDRPIFAWVIAIIIMLAGGLALFKLPVSMYPNVAPPAVEISATYPGASAKVVEDSVTQIIEQNMKGLDGLIYFSSNSSSNGQATI
TLTFESGTNPDIAQVQVQNKLQLAMPLLPQEVQRQGINVAKSSSGFLNAIAFVSENGSMDANDIADYVGSNVVDRLSRVPGVGNIQVFGG
KYAMRIWLDPNKLHTYGLSVPEVTAAIKAQNAQVAIGQLGGAPSVKGQQLNATINAQSRLQTPEQFRNIIVRGAQDGAELRLGDVARVEL
GAESYDFVTRYNGQPASGLAVTLATGANALDTAAGVDAALEDMKGFFPAGLKAEIPYDTTPFVRVSIKGVVQTLIEAIVLVFVVMYLFLQ
NFRATLIPTIAVPVVLLGTFGVLAMLGFSVNMLTMFAMVLAIGLLVDDAIVVVENVERIMSEEGLSPLEATRKSMGQITGALVGIGLVLS
AVFVPMAFMSGSTGVIYRQFSATIVSAMALSVLVAIVLTPALCATMLKPLKKGEHHVAHRGLAGRFFNGFNRGFDRTSESYQRGVRGIIH
RPWRFMGIVAALFVLMGVLFVRLPSSFLPNEDQGVLMALVQAPVGATQERTLESIAALENHFLQNEKDAVDSVFSVQGFSFAGMGQNAGM
AFVKLKDWSERDADNGVMPITGRAMAALGQIKDAFIFAFPPPAIPELGTASGYTFFLKDNSGQGHEALVAARNQLLGLAAGSKKLANVRP
NGQEDTPQFRIDIDAAKATSLGLSIDQINGTLAAAWGSSYIDDFVDRGRVKRVFVQADQAFRMVPEDFDLWSVKNDKGEMVPFSAFATKH
WDYGSPRLERYNGVSAMEIQGEPAPGVASGDAMAEIEQLAKQLPAGFGIEWTAMSYQERQAGSQTPLLYTLSLMIVFLCLAAMYESWSVP
TAVLLAAPLGILGAVLANTFKGLERDIYFQVAMLTTVGLTSKNAILIVEFAKENLEKGASLIESIMHAVRDRLRPIVMTSLAFGMGVVPL
AISTGAGSGAKQAIGTGVLGGMIVGTVLGVFFVPLFFVVVQRVFKRRSTT


>gb|AJ252200|+|1279-4401|smeE [Stenotrophomonas maltophilia]
ATGGCACGCTTTTTCATCGATCGACCCATCTTTGCGTGGGTGATCGCCATCATCATCATGCTCGCCGGCGGCCTGGCGCTGTTCAAGCTG
CCGGTCTCGATGTACCCCAACGTCGCACCGCCGGCGGTGGAAATCAGCGCCACCTACCCGGGTGCATCGGCCAAGGTGGTCGAGGACTCG
GTGACGCAGATCATCGAGCAGAACATGAAGGGCCTTGATGGCCTGATCTACTTCTCCTCCAACAGCTCGTCCAACGGCCAGGCCACCATC
ACCCTGACCTTCGAGAGCGGCACCAACCCGGATATCGCCCAGGTGCAGGTGCAGAACAAGCTGCAGCTGGCCATGCCGCTGCTGCCGCAG
GAAGTGCAGCGGCAGGGCATCAACGTGGCCAAGTCCAGCTCGGGCTTCCTGAACGCCATCGCGTTCGTGTCCGAGAACGGCAGCATGGAC
GCCAACGACATCGCCGACTACGTCGGTTCCAATGTCGTCGACCGCCTGAGCCGCGTGCCGGGCGTGGGCAACATCCAGGTGTTCGGTGGC
AAGTACGCCATGCGCATCTGGCTGGACCCGAACAAGCTGCATACCTATGGCCTGTCGGTGCCGGAAGTGACCGCCGCGATCAAGGCGCAG
AACGCCCAGGTGGCGATCGGCCAGCTCGGCGGTGCGCCGTCGGTGAAGGGCCAGCAGCTCAACGCCACCATCAACGCGCAGTCGCGCCTG
CAGACCCCGGAACAGTTCCGAAACATCATCGTGCGCGGTGCGCAGGACGGTGCCGAGCTGCGCCTGGGTGATGTCGCCCGCGTCGAGCTG
GGTGCCGAGTCCTACGACTTCGTCACCCGCTACAACGGCCAGCCGGCCAGTGGCCTGGCGGTCACCCTGGCCACCGGCGCCAACGCGCTG
GATACCGCGGCCGGTGTGGATGCCGCGCTGGAAGACATGAAGGGCTTCTTCCCGGCCGGCCTGAAGGCCGAGATCCCGTACGACACCACC
CCGTTCGTGCGCGTGTCGATCAAGGGCGTGGTGCAGACCCTGATCGAAGCGATCGTGCTGGTGTTCGTGGTGATGTACCTGTTCCTGCAG
AACTTCCGCGCCACGCTGATCCCGACCATCGCCGTGCCGGTGGTGCTGCTGGGTACCTTCGGCGTGCTGGCGATGCTGGGCTTCTCGGTG
AACATGCTGACCATGTTCGCGATGGTGCTGGCGATCGGCCTGCTGGTGGACGATGCCATCGTGGTGGTGGAGAACGTCGAGCGCATCATG
TCCGAGGAAGGGCTGTCGCCGCTCGAAGCGACCCGCAAGTCGATGGGCCAGATCACCGGTGCGCTGGTGGGTATCGGCCTGGTGCTGTCG
GCGGTGTTCGTGCCGATGGCCTTCATGAGCGGCTCCACCGGCGTGATCTATCGCCAGTTCTCGGCCACGATTGTCTCTGCGATGGCGTTG
TCGGTGCTGGTGGCGATCGTGCTGACCCCGGCACTGTGCGCGACCATGCTCAAGCCGCTGAAGAAGGGTGAGCACCACGTCGCCCACCGT
GGCCTGGCCGGTCGCTTCTTCAATGGCTTCAACCGTGGCTTCGATCGCACCAGCGAAAGCTACCAGCGCGGCGTGCGCGGCATCATCCAC
CGTCCGTGGCGCTTCATGGGCATCGTGGCGGCCTTGTTCGTGCTGATGGGCGTGCTGTTCGTGCGCCTGCCCAGCTCGTTCCTGCCCAAC
GAAGACCAGGGTGTGCTGATGGCGCTGGTGCAGGCGCCGGTCGGTGCCACCCAGGAACGCACGCTGGAATCGATCGCGGCACTGGAAAAC
CACTTCCTGCAGAACGAGAAGGATGCGGTGGACTCGGTGTTCTCCGTGCAGGGCTTCAGCTTCGCCGGCATGGGCCAGAACGCGGGCATG
GCGTTCGTCAAGCTGAAGGACTGGAGCGAGCGTGACGCCGACAATGGCGTGATGCCGATCACCGGACGTGCGATGGCGGCCCTGGGCCAG
ATCAAGGATGCCTTCATCTTCGCCTTCCCGCCGCCGGCCATTCCGGAGCTGGGGACCGCCTCGGGCTACACCTTCTTCCTGAAGGACAAC
AGCGGCCAGGGCCACGAGGCACTGGTGGCCGCGCGCAACCAGCTGCTCGGCCTGGCCGCAGGCAGCAAGAAGCTGGCCAACGTACGCCCG
AACGGCCAGGAAGACACGCCGCAGTTCCGCATCGACATCGACGCGGCCAAGGCGACCTCGCTGGGACTGTCGATCGACCAGATCAACGGC
ACGCTGGCGGCCGCGTGGGGCAGCTCGTACATCGATGACTTCGTCGATCGTGGCCGCGTCAAGCGCGTGTTCGTGCAGGCCGACCAGGCG
TTCCGCATGGTGCCGGAGGACTTCGATCTCTGGTCCGTGAAGAACGACAAGGGTGAGATGGTGCCGTTCAGCGCCTTCGCTACCAAGCAC
TGGGACTACGGTTCGCCGCGCCTGGAACGCTACAACGGTGTGTCGGCAATGGAAATCCAGGGCGAACCGGCCCCGGGTGTCGCCTCCGGT
GATGCCATGGCCGAGATCGAACAGCTGGCCAAGCAGCTGCCGGCGGGTTTCGGCATCGAATGGACGGCGATGTCCTACCAGGAACGCCAG
GCCGGCTCGCAGACGCCGCTGCTGTACACGCTGTCGCTGATGATCGTGTTCCTGTGCCTGGCCGCGATGTATGAAAGCTGGAGCGTACCG
ACCGCGGTGCTGCTGGCGGCCCCGCTGGGTATCCTCGGCGCGGTGCTGGCCAACACCTTCAAGGGCCTGGAGCGCGACATCTACTTCCAG
GTGGCGATGCTGACCACGGTGGGCCTGACCAGCAAGAACGCGATCCTGATCGTCGAGTTCGCCAAGGAAAACCTGGAAAAGGGCGCCAGC
CTGATCGAGTCGATCATGCACGCCGTGCGCGACCGCCTGCGCCCGATCGTGATGACCTCGCTCGCCTTCGGCATGGGCGTGGTACCGCTG
GCGATCTCCACCGGTGCCGGCTCCGGCGCCAAGCAGGCGATCGGCACCGGCGTGCTCGGCGGCATGATCGTCGGCACCGTGCTCGGCGTG
TTCTTCGTGCCGCTGTTCTTCGTGGTGGTGCAGCGCGTGTTCAAGCGCAGATCCACGACGTGA