mphF

Accession ARO:3003071
CARD Short NamemphF
DefinitionmphF is a macrolide phosphotransferase and resistance gene identified on the IncP plasmid pRSB111.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesPseudomonas aeruginosag, Vibrio choleraewgs
Resistomes with Sequence VariantsPseudomonas aeruginosag, Vibrio choleraewgs
Classification9 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
Publications

Szczepanowski R, et al. 2007. Antimicrob. Agents Chemother. 51(2):673-8 Novel macrolide resistance module carried by the IncP-1beta resistance plasmid pRSB111, isolated from a wastewater treatment plant. (PMID 17101677)

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Pseudomonas aeruginosa0.19%0%0%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAJ98570.1|+|mphF [uncultured bacterium]
MLHDTDRILKLAREAGLELAPGSLRLNEMGLDFQVAFGRDGDAVEWVLRMPRRTDVACAAVKEAKILDYFRSRLPVAVPDWKVFSDDLIA
YPSLPGNPGLTFDASTYETTWHFDQNSPVYVETLGAALAQLHGLDTDDAISAGLSNLSIDAVRENWTRDLETVEKSFEVPAARLALWRAW
LADLSFWPTHAASVHGDLYVGHVMVKSDGTVCGIIDWSEAHIGDPGIDLAGHLKVFGEASLRDLLGHYEAAGGQTWPRIVEHCKMLQSAE
GIRYAMFALKTGSAEHLEGAQGLLSAPGI


>gb|AM260957.1|+|4187-5086|mphF [uncultured bacterium]
ATGCTGCACGACACGGACCGAATACTGAAGCTGGCCAGGGAGGCAGGCTTGGAGCTTGCGCCCGGTTCCCTTAGGCTCAACGAAATGGGC
CTCGATTTCCAAGTTGCTTTCGGCAGGGATGGGGACGCTGTAGAGTGGGTTTTGCGGATGCCGCGCCGGACGGACGTGGCATGTGCGGCA
GTCAAGGAAGCGAAGATACTCGACTATTTCCGCAGTCGGCTGCCAGTCGCTGTGCCGGACTGGAAGGTCTTTAGCGATGATCTCATCGCC
TACCCCTCCCTGCCGGGCAATCCGGGGCTGACATTTGACGCCTCGACCTATGAGACGACCTGGCACTTTGACCAGAATTCTCCGGTCTAT
GTTGAAACGCTGGGCGCGGCGCTCGCGCAATTGCATGGGCTCGACACCGACGATGCAATTAGCGCGGGGCTAAGCAATCTCAGTATCGAT
GCCGTACGAGAGAACTGGACGCGCGATCTCGAAACTGTCGAGAAAAGCTTTGAGGTACCGGCAGCAAGACTTGCCCTCTGGCGCGCTTGG
CTTGCTGACTTGTCATTCTGGCCTACCCATGCCGCCTCAGTGCACGGCGATCTTTATGTCGGGCATGTCATGGTCAAATCGGACGGTACT
GTCTGCGGGATAATCGACTGGAGTGAGGCTCATATCGGCGATCCTGGAATCGATCTGGCTGGACATCTCAAGGTGTTCGGCGAAGCTAGC
CTGCGCGACCTCCTCGGTCACTACGAGGCGGCGGGGGGACAAACCTGGCCGCGTATAGTTGAGCATTGCAAGATGCTGCAGAGCGCCGAG
GGCATCCGATATGCTATGTTCGCCCTTAAGACGGGCAGCGCAGAGCATCTGGAGGGTGCCCAGGGGCTTTTGTCGGCGCCAGGGATTTGA