lsaB

Accession ARO:3003111
DefinitionLsaB is an ABC-F subfamily protein expressed in Staphylococcus sciuri. It confers resistance to clindamycin.
AMR Gene FamilyABC-F ATP-binding cassette ribosomal protection protein
Drug Classstreptogramin antibiotic, phenicol antibiotic, tetracycline antibiotic, pleuromutilin antibiotic, oxazolidinone antibiotic, macrolide antibiotic, lincosamide antibiotic
Resistance Mechanismantibiotic target protection
Classification14 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_drug_class lincosamide antibiotic [Drug Class]
+ confers_resistance_to_drug_class streptogramin antibiotic [Drug Class]
+ confers_resistance_to_antibiotic pleuromutilin [Antibiotic]
+ lsa-type ABC-F protein
Publications

Kehrenberg C, et al. 2004. J Antimicrob Chemother 54(5): 936-939. Nucleotide sequence and organization of the multiresistance plasmid pSCFS1 from Staphylococcus sciuri. (PMID 15471995)

Malbruny B, et al. 2011. Antimicrob Agents Chemother 55(4): 1470-1474. Cross-resistance to lincosamides, streptogramins A, and pleuromutilins due to the lsa(C) gene in Streptococcus agalactiae UCN70. (PMID 21245447)

Resistomes

Prevalence of lsaB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Staphylococcus aureus0%0.08%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|CAE18141.1|+|lsaB [Staphylococcus sciuri]
MSMIHVQNLTFSYPSSFDNIFEDVSFQIDTDWKLGFIGRNGRGKTTLFNLLLDKFEYRGKIISSVDFNYFPYPVEDKSKYTHEILEEICP
QAEDWEFLREIAYLNVDAEAMYRPFETLSNGEQTKVLLVALFLNEGQFLLIDEPTNHLDTEARKTVSNYLRKKKGNILISHDRNFLDGSV
DHILSINRADIEVQSGNYSSWKLNFDRQQGHEQATNERLQKDIGRLEQSTKRSAGWSNRVEASKNGTTNSGSKLDKGFVGHKAAKMMKRS
KNLEARQQKSIEEKSKLLKNIEKTESLQFEPVEYKSKELIQLTDVSVIYDGQVVNKPISFNVEQGDRIVLDGKNGSGKSSILKLILGDPI
QYTGTLNTGSNLITSYVQQDTSHLKGMLADFIEENEIDESLFKAILRKLDFDRVQFEKDISHYSGGQKKKLLIAKSLCEKAHLYIWDEPL
NFIDIYSRMQIEELIQTFNPTMVFVEHDQTFQETISTKIIKI


>gb|AJ579365.1|+|4150-5628|lsaB [Staphylococcus sciuri]
ATGTCAATGATACATGTACAAAATTTAACTTTCTCTTATCCGAGTAGTTTTGATAATATCTTTGAAGATGTAAGCTTTCAAATTGATACA
GATTGGAAGCTTGGATTTATTGGTCGAAATGGACGAGGGAAAACAACCCTTTTTAATTTATTACTAGATAAATTTGAATATAGGGGGAAA
ATCATTTCTTCGGTCGATTTTAACTACTTCCCATATCCAGTAGAAGATAAAAGTAAGTATACACATGAAATTTTAGAAGAAATATGCCCT
CAAGCTGAGGACTGGGAATTTCTTCGAGAAATAGCTTATTTAAATGTGGATGCCGAAGCCATGTACCGTCCTTTTGAAACTTTATCAAAC
GGTGAACAAACAAAGGTATTGCTTGTTGCTCTATTTTTAAACGAAGGACAATTTTTATTAATTGATGAACCAACAAATCATTTAGATACT
GAAGCTCGTAAGACGGTTTCGAATTACTTGAGGAAGAAAAAAGGGAATATTTTAATTTCTCATGACCGTAACTTTTTAGATGGCAGTGTT
GATCATATCTTGTCTATAAATAGAGCAGATATTGAGGTTCAAAGTGGAAATTATTCCTCATGGAAGTTGAACTTTGACCGACAGCAGGGA
CATGAACAAGCAACAAATGAACGCTTGCAGAAGGATATTGGAAGGTTAGAACAATCTACAAAACGTTCGGCTGGTTGGTCTAACCGAGTC
GAAGCTTCAAAAAATGGAACAACGAATTCTGGTTCTAAATTGGACAAAGGTTTTGTAGGACATAAAGCAGCAAAAATGATGAAACGATCT
AAGAACCTTGAGGCTCGACAGCAAAAATCGATTGAAGAAAAGTCAAAGCTTCTAAAAAACATTGAAAAAACGGAGTCCCTACAGTTTGAA
CCAGTGGAATATAAATCGAAGGAACTCATTCAATTAACAGATGTGTCTGTCATATATGATGGGCAAGTTGTCAACAAACCAATAAGTTTT
AATGTTGAACAAGGAGATAGAATTGTACTGGATGGAAAGAACGGCAGTGGAAAAAGTAGTATTTTAAAATTAATCTTAGGCGATCCAATA
CAGTATACAGGCACGTTAAATACGGGTTCTAACCTGATAACTTCTTATGTTCAGCAAGACACCTCTCATTTAAAGGGGATGCTAGCTGAC
TTTATTGAAGAAAATGAGATTGATGAATCGTTGTTTAAGGCCATCCTGAGAAAGCTAGATTTTGACCGAGTACAGTTTGAAAAAGATATA
TCTCATTATTCAGGTGGTCAGAAGAAAAAATTGCTTATCGCTAAAAGTTTATGTGAAAAAGCTCACCTATATATTTGGGATGAACCATTA
AACTTTATTGATATTTACTCTCGAATGCAAATTGAAGAGCTTATTCAAACCTTTAATCCGACTATGGTTTTTGTTGAACATGACCAGACC
TTCCAAGAGACAATATCAACAAAAATAATAAAAATATAA