AAC(6')-Ian

Accession ARO:3003200
CARD Short NameAAC(6')-Ian
DefinitionAAC(6')-Ian is an amikacin acetyltransferase gene found on a transferable plasmid of the Serratia marcescens strain NUBL-11663. It catalyzes the transfer of an acetyl group from acetyl coenzyme A onto an amine at the 6'-position of various aminoglycosides.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisp, Serratia marcescenswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Citrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisp, Serratia marcescenswgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
Publications

Jin W, et al. 2015. J Antimicrob Chemother 70(5): 1331-1337. New plasmid-mediated aminoglycoside 6'-N-acetyltransferase, AAC(6')-Ian, and ESBL, TLA-3, from a Serratia marcescens clinical isolate. (PMID 25576529)

Resistomes

Prevalence of AAC(6')-Ian among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii3.42%0.36%4.44%0%
Citrobacter freundii0%0%0.24%0%
Enterobacter asburiae0%0%0.44%0%
Enterobacter hormaechei0%0%0.14%0%
Escherichia coli0%0.01%0.01%0%
Klebsiella pneumoniae0%0.01%0.11%0%
Klebsiella quasipneumoniae0%0%0.49%0%
Proteus mirabilis0%1.49%0%0%
Serratia marcescens0%0%0.14%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 330


>gb|BAQ22025.1|-|AAC(6')-Ian [Serratia marcescens]
MLVQQGRLAIRALQKSDAPVMLRWLQDERVLEFYEGRDKHFDLQTVIEVFIEDQGETTPCLVLLDDKPLGYVQFYPLDSEDKQALELPVE
DVIYGLDQFIGEPDFWGLGLGTELVSLVRDYLITDKAAQRLVLDPQSRNSRAIACYEKCGFEKLRLLPAHEMHEGQLQDCWLMQYYPARS
SLMASSRPKI


>gb|AP014611.1|-|26118-26690|AAC(6')-Ian [Serratia marcescens]
ATGCTGGTGCAGCAAGGCAGATTGGCAATACGTGCATTACAGAAAAGCGATGCGCCGGTGATGCTGCGCTGGCTGCAGGATGAGCGGGTG
CTGGAATTTTACGAAGGGCGTGACAAACACTTCGATCTGCAAACGGTCATTGAAGTTTTTATCGAGGATCAGGGGGAAACCACACCGTGT
CTGGTGTTACTGGATGATAAACCGCTTGGTTATGTGCAGTTCTACCCGCTGGATAGCGAAGATAAACAGGCGCTGGAACTACCGGTTGAG
GATGTGATCTACGGGCTGGATCAGTTTATCGGCGAACCGGATTTCTGGGGGCTGGGACTTGGTACTGAGCTTGTCTCGCTGGTGCGCGAT
TATCTCATAACAGACAAGGCCGCACAGCGCCTTGTTCTCGACCCGCAAAGCCGCAACTCACGCGCAATTGCCTGCTATGAAAAATGCGGC
TTTGAAAAACTCCGCTTGCTGCCCGCCCATGAAATGCATGAAGGGCAGCTGCAAGATTGCTGGCTGATGCAGTATTATCCCGCGCGCAGC
AGTCTGATGGCTTCGTCACGCCCGAAAATATAG