Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones

Accession ARO:3003684
CARD Short NamePaer_gyrA_FLO
DefinitionPoint mutation of Pseudomonas aeruginosa gyrA resulted in the lowered affinity between fluoroquinolones and gyrA. Thus, conferring resistance.
AMR Gene Familyfluoroquinolone resistant gyrA
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsPseudomonas aeruginosag+p+wgs, Pseudomonas mendocinawgs, Pseudomonas monteiliig+wgs, Pseudomonas putidag+wgs, Pseudomonas stutzeriwgs
Classification11 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ fluoroquinolone resistant gyrA [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic pefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic levofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic sparfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic sitafloxacin [Antibiotic]
Publications

Yonezawa M, et al. 1995. Antimicrob. Agents Chemother. 39(9):1970-2 DNA gyrase gyrA mutations in quinolone-resistant clinical isolates of Pseudomonas aeruginosa. (PMID 8540700)

Salma R, et al. 2013. J. Infect. Chemother. 19(1):77-81 gyrA and parC mutations in quinolone-resistant clinical isolates of Pseudomonas aeruginosa from Nini Hospital in north Lebanon. (PMID 22821356)

Resistomes

Prevalence of Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Pseudomonas aeruginosa42.96%0.96%22.94%0%
Pseudomonas mendocina0%0%7.69%0%
Pseudomonas monteilii33.33%0%17.5%0%
Pseudomonas putida16%0%8.9%0%
Pseudomonas stutzeri0%0%13.46%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 1500

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:

PMID: 8540700T83I T83I,D87H T83I,D87N T83I,D87G D87N
PMID: 22821356H80R T83I

>gb|AAG06556.1|-|Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones [Pseudomonas aeruginosa PAO1]
MGELAKEILPVNIEDELKQSYLDYAMSVIVGRALPDARDGLKPVHRRVLYAMSELGNDWN
KPYKKSARVVGDVIGKYHPHGDTAVYDTIVRMAQPFSLRYMLVDGQGNFGSVDGDNAAAM
RYTEVRMAKLAHELLADLEKETVDWVPNYDGTEQIPAVMPTKIPNLLVNGSSGIAVGMAT
NIPPHNLGEVIDGCLALMDNPDLTVDELMQYIPGPDFPTAGIINGRAGIIEAYRTGRGRI
YIRARAVVEEMEKGGGREQIIITELPYQLNKARLIEKIAELVKEKKIEGISELRDESDKD
GMRVVIELRRGEVGEVVLNNLYAQTQLQSVFGINVVALVDGQPRTLNLKDMLEVFVRHRR
EVVTRRTVYELRKARERGHILEGQAVALSNIDPVIELIKSSPTPAEAKERLIATAWESSA
VEAMVERAGADACRPEDLDPQYGLRDGKYYLSPEQAQAILELRLHRLTGLEHEKLLSEYQ
EILNLIGELIRILTNPARLMEVIREELEAVKAEFGDARRTEIVASQVDLTIADLITEEDR
VVTISHGGYAKSQPLAAYQAQRRGGKGKSATGMKDEDYIEHLLVANSHATLLLFSSKGKV
YWLRTFEIPEASRTARGRPLVNLLPLDEGERITAMLQIDLEALQQNGGADDDLDEAEGAV
LEGEVVEAAEVEEVEGETAELVAEPTGAYIFMATAFGTVKKTPLVQFSRPRSSGLIALKL
EEGDTLIAAAITDGAKEVMLFSSAGKVIRFAESVVRIMGRNARGVRGMRLGKGQQLISML
IPESGAQILTASERGFGKRTPLSKFPRRGRGGQGVIAMVTNERNGALIAAVQVQEGEEIM
LISDQGTLVRTRVDEVSLSGRNTQGVTLIKLASDEVLVGLERVQEPSGGDDEDLPEGEEA
AESLGESAESESEPAAEAEGNEE



>gb|AE004091.2|-|3556427-3559198|Pseudomonas aeruginosa gyrA conferring resistance to fluoroquinolones [Pseudomonas aeruginosa PAO1]
ATGGGCGAACTGGCCAAAGAAATTCTCCCGGTCAATATCGAAGACGAGCTGAAACAGTCCTATCTCGACTACGCGATGAGCGTGATCGTC
GGGCGGGCCCTGCCGGATGCACGTGACGGCCTGAAGCCGGTGCACCGCCGTGTGCTTTATGCCATGAGCGAGCTGGGCAACGACTGGAAC
AAGCCCTACAAGAAATCCGCCCGTGTGGTCGGCGACGTGATCGGTAAGTACCACCCGCACGGCGACACCGCGGTCTACGACACCATCGTG
CGCATGGCGCAGCCGTTCTCGCTGCGCTACATGCTGGTAGACGGCCAGGGCAACTTCGGTTCGGTGGACGGCGACAACGCCGCAGCCATG
CGATACACCGAAGTGCGCATGGCCAAGCTGGCCCACGAACTGCTGGCGGACCTGGAAAAGGAAACCGTCGACTGGGTGCCCAACTACGAT
GGCACCGAGCAGATCCCGGCGGTCATGCCGACCAAGATTCCCAACCTGCTGGTCAACGGTTCCAGCGGTATCGCCGTGGGCATGGCGACC
AACATCCCGCCGCACAACCTCGGCGAAGTGATCGACGGCTGCCTGGCGCTGATGGACAACCCCGACCTGACCGTCGATGAGCTGATGCAG
TACATCCCCGGTCCGGACTTCCCCACCGCCGGCATCATCAACGGCCGCGCCGGGATCATCGAGGCCTACCGCACCGGTCGCGGGCGCATC
TACATCCGTGCCCGCGCCGTCGTCGAGGAGATGGAGAAGGGCGGCGGTCGCGAGCAGATTATCATCACCGAGCTGCCGTACCAGTTGAAC
AAGGCGCGGTTGATCGAGAAGATCGCCGAGCTGGTGAAAGAGAAGAAGATCGAGGGTATTTCCGAGCTGCGCGACGAGTCTGACAAGGAC
GGCATGCGCGTGGTCATCGAGCTGCGTCGCGGCGAGGTGGGCGAGGTGGTCCTCAACAACCTCTATGCCCAGACCCAGCTGCAGAGCGTG
TTCGGCATCAACGTGGTGGCCCTGGTCGACGGCCAGCCGCGCACGCTGAACCTGAAGGACATGCTCGAGGTGTTCGTCCGCCACCGCCGC
GAAGTGGTGACCCGGCGTACCGTCTACGAGCTGCGCAAGGCCCGCGAGCGCGGGCACATCCTGGAAGGCCAGGCGGTCGCCCTGTCGAAC
ATCGACCCGGTGATCGAGCTGATCAAGAGTTCGCCGACCCCGGCCGAGGCCAAGGAACGCCTGATCGCCACTGCCTGGGAGTCCAGCGCG
GTGGAAGCGATGGTCGAGCGTGCCGGCGCCGACGCCTGTCGTCCGGAAGACCTGGATCCGCAGTACGGCCTGCGCGACGGCAAGTACTAC
CTGTCGCCGGAGCAGGCCCAGGCGATCCTCGAGCTGCGCCTGCATCGCCTGACCGGCCTGGAGCACGAGAAGCTGCTCTCCGAATACCAG
GAAATCCTCAACCTGATCGGCGAGCTGATCCGCATCCTGACCAACCCGGCGCGCCTGATGGAGGTGATCCGTGAGGAACTGGAAGCGGTC
AAGGCCGAATTCGGCGATGCTCGCCGCACCGAGATCGTGGCTTCCCAGGTCGACCTGACCATCGCCGACCTGATCACCGAGGAAGACCGC
GTGGTGACCATCTCGCACGGCGGCTACGCCAAGTCCCAGCCGCTGGCCGCCTACCAGGCGCAGCGTCGCGGCGGCAAAGGCAAGTCCGCC
ACCGGGATGAAGGACGAGGACTACATCGAACACCTGCTGGTGGCCAACAGCCATGCGACCCTCCTGCTGTTCTCCAGCAAGGGCAAGGTC
TACTGGCTGCGTACCTTCGAGATTCCGGAAGCCTCGCGTACCGCGCGTGGCCGGCCGCTGGTGAACCTGCTGCCGCTGGATGAGGGCGAG
CGGATCACCGCGATGTTGCAGATCGACCTGGAGGCGCTGCAGCAGAACGGTGGCGCCGATGACGACCTCGACGAAGCCGAAGGCGCGGTG
CTCGAGGGCGAGGTGGTCGAGGCCGCCGAGGTCGAGGAAGTCGAGGGCGAGACCGCCGAGCTGGTGGCCGAGCCGACCGGCGCCTACATC
TTCATGGCCACCGCCTTCGGTACCGTGAAGAAGACCCCGCTGGTGCAGTTCAGCCGTCCGCGCAGCAGCGGCCTGATCGCGCTCAAGCTG
GAAGAGGGCGACACCCTGATCGCCGCCGCGATCACCGATGGCGCCAAGGAAGTCATGCTGTTCTCCAGCGCCGGCAAGGTGATCCGCTTC
GCCGAGAGCGTGGTGCGCATCATGGGCCGCAACGCCCGCGGCGTACGTGGCATGCGCCTGGGCAAGGGGCAGCAGCTGATCTCCATGCTG
ATTCCGGAGTCCGGGGCGCAGATCCTCACCGCCTCCGAGCGCGGCTTCGGCAAGCGTACCCCGCTGAGCAAGTTCCCGCGTCGCGGCCGC
GGCGGCCAGGGGGTGATCGCCATGGTCACCAACGAGCGCAACGGCGCGCTGATCGCCGCGGTACAGGTCCAGGAAGGCGAGGAGATCATG
CTGATTTCCGACCAGGGCACCCTGGTGCGGACGCGTGTCGACGAAGTCTCCCTGTCCGGCCGCAATACCCAGGGCGTAACCCTGATCAAG
CTCGCCAGCGACGAGGTACTGGTCGGTCTGGAGCGTGTCCAGGAGCCGTCGGGCGGAGATGACGAGGACCTGCCCGAGGGCGAGGAAGCT
GCCGAATCTCTGGGCGAGTCGGCCGAGTCCGAGTCCGAGCCCGCGGCGGAAGCGGAAGGCAACGAAGAGTAA