Acinetobacter baumannii OprD conferring resistance to imipenem

Accession ARO:3003809
DefinitionAn outer member protein (OMP) found in Acinetobacter baumannii involved in the uptake of imipenem and basic amino acids. This porin is homologous to Pseudomonas aeruginosa OprD, which performs an identical function.
AMR Gene FamilyOuter Membrane Porin (Opr)
Drug Classpenem, carbapenem, cephamycin, cephalosporin, monobactam, penam
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic imipenem [Antibiotic]
+ gene conferring resistance via absence
+ Outer Membrane Porin (Opr) [AMR Gene Family]
Publications

Dupont M, et al. . J. Proteome Res. 4(6):2386-90 Identification of an OprD homologue in Acinetobacter baumannii. (PMID 16335991)

Resistomes

Prevalence of Acinetobacter baumannii OprD conferring resistance to imipenem among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 800


>gb|AHB92962.1|+|Acinetobacter OprD conferring resistance to imipenem [Acinetobacter baumannii ZW85-1]
MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRTGYISRDKKNGVDDTSSFAQTAIVNIESGFTPGIVGFGVGVVGDGSF
KIGANKNAGNNMIPRETGFNDEGVLTKGAGDSYDHWARGGGSVKARFSNTTVRYGTQVLDLPVLASNTARLVPEYFTGTLLTSHEIKDLE
VIAGKFTKDQYSDQVNTDGRHLDRAIVWGAKYKFDDNLNASYYGLDSKDKLERHYLNVNYKQPLANDSSLTYDFSGYHTKFDEGASTYSQ
TTDDLSNRKNNIWAISTAYNTGPHNIMVAYQQNSGNVGYDYGENADGGQSIYLPNSYLSDFIGNDEKSAQIQYSLDFGKLGVLPGLNWTT
AFVYGWDIKVKGLTDDAEEREFFNQVKYTVQSGFAKDASLRIRNSYYRASNAYQTNAYIGDTNEWRIFLDIPVKLF


>gb|CP006768.1|+|3513470-3514780|Acinetobacter OprD conferring resistance to imipenem [Acinetobacter baumannii ZW85-1]
ATGCTAAAAGCACAAAAACTTACATTAGCAGTTCTCATTTCTGCGGCAATAATTTCCTCAGCTCAGGCAAGCGAGCAAAGTGAGGCAAAA
GGATTTGTTGAAGATGCGAACGGTTCTATTCTCTTCCGTACAGGTTACATCAGCCGTGACAAAAAAAATGGCGTAGATGACACCAGTTCA
TTTGCTCAAACAGCAATCGTAAATATTGAATCTGGCTTTACTCCTGGTATTGTTGGTTTCGGTGTGGGCGTTGTTGGTGACGGTTCATTT
AAAATCGGCGCAAATAAAAACGCTGGCAATAACATGATTCCACGTGAAACTGGTTTCAATGACGAAGGCGTGCTAACAAAAGGTGCTGGT
GATTCTTACGATCACTGGGCTCGTGGTGGCGGTAGCGTAAAAGCACGTTTCTCAAATACAACTGTACGTTACGGTACTCAAGTACTTGAC
CTGCCAGTTCTTGCAAGTAATACAGCACGTTTAGTGCCTGAATACTTCACAGGTACTTTATTAACCAGCCATGAAATTAAAGATTTAGAA
GTGATTGCTGGTAAATTCACTAAAGATCAATATTCTGACCAAGTGAACACCGATGGCCGTCATCTTGACCGTGCAATTGTGTGGGGTGCT
AAATACAAGTTTGATGATAATTTAAATGCATCTTACTATGGTTTAGATAGTAAAGATAAACTTGAACGTCATTACCTCAATGTAAACTAT
AAACAACCATTGGCGAATGACAGCTCATTAACTTACGATTTCAGTGGTTATCACACTAAGTTTGATGAAGGTGCTTCTACTTATTCACAA
ACTACTGATGACCTATCTAACCGTAAAAACAATATTTGGGCAATTTCTACAGCCTATAATACTGGTCCACATAACATCATGGTGGCTTAC
CAACAAAACAGTGGTAATGTCGGTTATGACTATGGTGAAAATGCTGACGGCGGTCAAAGTATTTATCTGCCAAATTCTTATTTGTCTGAT
TTCATCGGTAATGATGAAAAATCAGCACAAATCCAATATAGCCTCGATTTCGGTAAGTTAGGCGTATTACCTGGCTTAAACTGGACCACT
GCATTTGTATACGGTTGGGACATCAAAGTTAAAGGTTTAACTGATGATGCTGAAGAACGCGAATTCTTTAACCAAGTGAAATACACAGTT
CAAAGTGGTTTCGCTAAAGATGCAAGCCTTCGTATTCGTAACTCATACTACCGTGCAAGCAATGCTTATCAAACGAATGCCTACATCGGT
GATACCAATGAATGGCGTATTTTCTTAGATATTCCTGTGAAATTATTCTAA