Moraxella catarrhalis M35

Accession ARO:3004124
DefinitionThe outer membrane protein M35 of Moraxella catarrhalis is an antigenically conserved porin. Down-regulation of M35 significantly increases the MICs of aminopenicillins, specifically amoxicillin.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenam, monobactam, penem, cephamycin, carbapenem, cephalosporin
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification16 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Jetter M, et al. 2010. J. Antimicrob. Chemother. 65(10):2089-96 Down-regulation of porin M35 in Moraxella catarrhalis by aminopenicillins and environmental factors and its potential contribution to the mechanism of resistance to aminopenicillins. (PMID 20801781)

Easton DM, et al. 2005. J. Bacteriol. 187(18):6528-35 Characterization of a novel porin protein from Moraxella catarrhalis and identification of an immunodominant surface loop. (PMID 16159786)

Resistomes

Prevalence of Moraxella catarrhalis M35 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 650

Type of Antibiotic Resistance: Intrinsic or chromosomally-encoded


>gb|AAX99225|+|Moraxella catarrhalis M35 [Moraxella catarrhalis]
MKKLALATAVAALSVSAAQATPTVYGKAFLTVDANNTDTTYNSGLVQLSEDTNESGLNSNTSRIGFKGSEALNANTDVVYQLEYKIDIDA
DRGDNFKSRDTYLGLAHKQYGTLLAGRLTTIDDSVDFASMLEDNNVADIGPTFNAPRANNAFAYVSPEYNGTQFLAMYAFDSDTDKGGLA
KDDQFGVGATYSTGPINAGATYIHYGDDSHIRLSGNYAVSPALTVGALYQISEFGVAAKNQKASPLSEGKVGDKKENTLIVSGEMKTATP
WTAYGQATLIKNVAGNDGDESVGVGIGGKYAFNKATTGHVYTGYVNSERKNVKYEGSNETHKNAHKDTKFDGYKNSGFGIGAGLEYKF


>gb|AY905613|+|1-1077|Moraxella catarrhalis M35 [Moraxella catarrhalis]
ATGAAAAAACTTGCTCTAGCAACCGCTGTCGCTGCTTTATCTGTATCTGCTGCACAAGCAACACCGACTGTTTACGGTAAAGCGTTTTTA
ACTGTTGATGCCAACAATACTGATACAACTTATAATTCAGGTCTTGTACAATTATCTGAAGATACCAATGAAAGCGGGCTTAACTCAAAT
ACCTCACGCATTGGTTTTAAAGGTTCTGAAGCTTTAAATGCTAATACTGATGTTGTGTATCAACTTGAATATAAGATTGACATTGATGCT
GATCGTGGCGATAACTTTAAATCTCGTGATACTTACCTAGGTCTTGCTCATAAACAATACGGCACATTGTTGGCTGGTCGCTTAACGACT
ATTGATGACAGTGTTGATTTTGCCAGCATGTTGGAAGATAATAATGTCGCTGACATCGGTCCTACTTTTAATGCCCCTCGTGCCAACAAT
GCCTTTGCTTATGTATCACCTGAGTATAATGGTACTCAGTTCTTAGCTATGTATGCATTTGACTCAGATACTGACAAGGGCGGTCTTGCC
AAAGATGACCAGTTTGGTGTGGGTGCAACTTATAGCACAGGCCCTATCAATGCAGGTGCGACTTATATTCACTACGGTGATGACAGTCAC
ATTCGCCTATCTGGCAACTATGCGGTTTCTCCAGCATTGACTGTAGGTGCTTTATATCAAATCTCAGAATTTGGTGTCGCTGCCAAAAAT
CAAAAAGCCAGTCCTTTGTCTGAGGGCAAGGTAGGCGATAAAAAAGAAAACACCCTTATCGTGAGTGGCGAGATGAAAACTGCCACGCCA
TGGACAGCCTATGGTCAGGCAACTTTGATTAAAAATGTTGCTGGTAATGATGGCGATGAGTCAGTGGGTGTTGGTATTGGTGGTAAATAT
GCCTTTAATAAAGCCACCACAGGTCATGTCTACACTGGCTATGTCAACAGCGAGCGTAAAAATGTCAAGTATGAGGGCAGTAATGAAACA
CATAAAAATGCACACAAAGATACAAAGTTTGATGGTTATAAGAACAGTGGCTTTGGTATCGGCGCAGGTTTAGAATATAAATTCTAA