Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004446
CARD Short NameHinf_PBP3_BLA
DefinitionPBP3 is a penicillin-binding protein and beta-lactam resistance enzyme encoded by the ftsI gene in Haemophilus influenzae. Mutations in ftsI confer resistance to beta-lactam antibiotics.
AMR Gene Familypenicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanismantibiotic target alteration
Classification72 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ antibiotic molecule
+ beta-lactam antibiotic
+ penicillin beta-lactam [Drug Class]
+ cephalosporin [Drug Class]
+ beta-lactamase resistant penicillin
+ beta-lactamase sensitive penicillin
+ penicillin with extended spectrum
+ other cephalosporins and penems
+ fourth-generation cephalosporin [Drug Subclass]
+ third-generation cephalosporin [Drug Subclass]
+ second-generation cephalosporin [Drug Subclass]
+ first-generation cephalosporin [Drug Subclass]
+ antibiotic target
+ mechanism of antibiotic resistance
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ moxalactam [Antibiotic]
+ loracarbef [Antibiotic]
+ cefradine [Antibiotic]
+ cephapirin [Antibiotic]
+ ceftizoxime [Antibiotic]
+ ceftiofur [Antibiotic]
+ cefprozil [Antibiotic]
+ cefonicid [Antibiotic]
+ cefmetazole [Antibiotic]
+ mecillinam [Antibiotic]
+ cell wall synthesis enzyme targeted by antibiotic
+ cefalotin [Antibiotic]
+ ceftaroline [Antibiotic]
+ cefdinir [Antibiotic]
+ cefditoren [Antibiotic]
+ ceftibuten [Antibiotic]
+ cefpodoxime [Antibiotic]
+ cefixime [Antibiotic]
+ cefotaxime [Antibiotic]
+ cefaclor [Antibiotic]
+ cefotiam [Antibiotic]
+ cefadroxil [Antibiotic]
+ cefalexin [Antibiotic]
+ doripenem [Antibiotic]
+ mezlocillin [Antibiotic]
+ azlocillin [Antibiotic]
+ ampicillin [Antibiotic]
+ flucloxacillin [Antibiotic]
+ dicloxacillin [Antibiotic]
+ propicillin [Antibiotic]
+ phenoxymethylpenicillin [Antibiotic]
+ benzylpenicillin [Antibiotic]
+ aztreonam [Antibiotic]
+ imipenem [Antibiotic]
+ antibiotic target alteration [Resistance Mechanism]
+ piperacillin [Antibiotic]
+ meropenem [Antibiotic]
+ ertapenem [Antibiotic]
+ amoxicillin [Antibiotic]
+ cefuroxime [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftobiprole [Antibiotic]
+ ceftazidime [Antibiotic]
+ cefepime [Antibiotic]
+ cefazolin [Antibiotic]
+ oxacillin [Antibiotic]
+ carbenicillin [Antibiotic]
+ methicillin [Antibiotic]
+ cloxacillin [Antibiotic]
+ cefoxitin [Antibiotic]
+ beta-lactam sensitive penicillin-binding protein
+ mutation conferring antibiotic resistance
+ determinant of antibiotic resistance
+ beta-lactam resistant penicillin-binding proteins
+ antibiotic resistance gene variant or mutant
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefaclor [Antibiotic]
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ confers_resistance_to_antibiotic cefditoren [Antibiotic]
+ confers_resistance_to_antibiotic cefdinir [Antibiotic]
+ penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics [AMR Gene Family]
Resistomes with Sequence VariantsActinobacillus indolicusg+wgs, Actinobacillus pleuropneumoniaeg+wgs, Actinobacillus porcitonsillarumg, Aggregatibacter actinomycetemcomitansg+wgs, Avibacterium paragallinarumg+wgs, Citrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Cronobacter condimentig+wgs, Cronobacter dublinensisg+wgs, Cronobacter malonaticusg+wgs, Cronobacter sakazakiig+wgs, Cronobacter turicensiswgs, Cronobacter universalisg+wgs, Edwardsiella tardag+wgs, Enterobacter asburiaeg+wgs, Enterobacter cancerogenusg+wgs, Enterobacter chengduensisg+wgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Glaesserella parasuisg+wgs, Haemophilus influenzaeg+wgs, Haemophilus parainfluenzaeg+wgs, Klebsiella aerogenesg+wgs, Klebsiella huaxiensisg+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaeg+wgs, Kosakonia arachidisg+wgs, Leclercia adecarboxylatag+wgs, Leminorella grimontiiwgs, Morganella morganiig+wgs, Pasteurella multocidag+wgs, Pectobacterium parmentierig+wgs, Photorhabdus asymbioticag+wgs, Plesiomonas shigelloidesg+wgs, Proteus columbaeg+wgs, Proteus mirabilisg+wgs, Proteus pennerig+wgs, Proteus vulgarisg+wgs, Providencia alcalifaciensg+wgs, Providencia heimbachaeg+wgs, Providencia rettgerig+wgs, Providencia stuartiig+wgs, Raoultella planticolag+wgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Serratia liquefaciensg+wgs, Serratia marcescensg+p+wgs, Serratia odoriferag+wgs, Serratia rubidaeag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Vibrio parahaemolyticusg+wgs, Vibrio vulnificusg+wgs, Yersinia canariaeg+wgs, Yersinia enterocoliticag+wgs, Yersinia kristenseniig+wgs, Yersinia pestisg+wgs, Yersinia pseudotuberculosisg+wgs
Publications

Misawa K, et al. 2018. BMC Res Notes 11(1):53 Single nucleotide polymorphisms in genes encoding penicillin-binding proteins in β-lactamase-negative ampicillin-resistant Haemophilus influenzae in Japan. (PMID 29352811)

Resistomes

Prevalence of Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Actinobacillus indolicus100%0%100%0%0%
Actinobacillus pleuropneumoniae97.22%0%100%0%0%
Actinobacillus porcitonsillarum100%0%0%0%0%
Aggregatibacter actinomycetemcomitans100%0%100%0%0%
Avibacterium paragallinarum93.75%0%100%0%0%
Citrobacter amalonaticus100%0%100%0%0%
Citrobacter freundii100%0%99.23%0%0%
Citrobacter koseri100%0%100%0%0%
Citrobacter portucalensis100%0%100%0%0%
Citrobacter werkmanii100%0%100%0%0%
Citrobacter youngae100%0%100%0%0%
Cronobacter condimenti100%0%100%0%0%
Cronobacter dublinensis100%0%97.44%0%0%
Cronobacter malonaticus100%0%98.18%0%0%
Cronobacter sakazakii100%0%99.33%0%0%
Cronobacter turicensis0%0%100%0%0%
Cronobacter universalis100%0%66.67%0%0%
Edwardsiella tarda100%0%93.33%0%0%
Enterobacter asburiae100%0%99.6%0%0%
Enterobacter cancerogenus100%0%100%0%0%
Enterobacter chengduensis100%0%100%0%0%
Enterobacter cloacae100%0%99.36%0%0%
Enterobacter hormaechei99.28%0%99.74%0%0%
Enterobacter kobei100%0%100%0%0%
Enterobacter roggenkampii97.67%0%99.64%0%0%
Escherichia albertii100%0%99.35%0%0%
Escherichia coli67.75%0.01%99.32%0%99.82%
Escherichia fergusonii100%0%100%0%0%
Escherichia marmotae100%0%97.92%0%0%
Glaesserella parasuis100%0%98.97%0%0%
Haemophilus influenzae41.24%0%30.25%0%0%
Haemophilus parainfluenzae100%0%100%0%0%
Klebsiella aerogenes100%0%96.89%0%0%
Klebsiella huaxiensis100%0%100%0%0%
Klebsiella michiganensis100%0%100%0%0%
Klebsiella oxytoca100%0%100%0%0%
Klebsiella pneumoniae99.53%0%99.52%0%0%
Klebsiella quasipneumoniae100%0%99.61%0%0%
Kosakonia arachidis100%0%100%0%0%
Leclercia adecarboxylata92.86%0%100%0%0%
Leminorella grimontii0%0%85.71%0%0%
Morganella morganii96.15%0%99.39%0%0%
Pasteurella multocida100%0%99.63%0%0%
Pectobacterium parmentieri100%0%94.12%0%0%
Photorhabdus asymbiotica100%0%100%0%0%
Plesiomonas shigelloides87.5%0%93.1%0%0%
Proteus columbae100%0%100%0%0%
Proteus mirabilis100%0%99.01%0%0%
Proteus penneri100%0%100%0%0%
Proteus vulgaris100%0%100%0%0%
Providencia alcalifaciens100%0%100%0%0%
Providencia heimbachae100%0%100%0%0%
Providencia rettgeri100%0%100%0%0%
Providencia stuartii100%0%100%0%0%
Raoultella planticola100%0%100%0%0%
Salmonella bongori100%0%100%0%0%
Salmonella enterica95.71%0%99.47%0%0%
Serratia liquefaciens100%0%98.41%0%0%
Serratia marcescens99.24%0.65%98.17%0%0%
Serratia odorifera100%0%80%0%0%
Serratia rubidaea100%0%100%0%0%
Shigella boydii100%0%100%0%0%
Shigella dysenteriae100%0%100%0%0%
Shigella flexneri96%0%99.69%0%0%
Shigella sonnei100%0%99.34%0%0%
Vibrio parahaemolyticus18.83%0%36.66%0%0%
Vibrio vulnificus49.09%0%98.78%0%0%
Yersinia canariae100%0%100%0%0%
Yersinia enterocolitica100%0%99.55%0%0%
Yersinia kristensenii100%0%100%0%0%
Yersinia pestis100%0%99.02%0%0%
Yersinia pseudotuberculosis100%0%98.53%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 500

Type of Antibiotic Resistance: Acquired

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
D350Nsingle resistance variantPMID:29352811
S357Nsingle resistance variantPMID:29352811
S385Tsingle resistance variantPMID:29352811
L389Fsingle resistance variantPMID:29352811
V562Lsingle resistance variantPMID:29352811

>gb|AAC22787.1|+|Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics [Haemophilus influenzae Rd KW20]
MVKFNSSRKSGKSKKTIRKLTAPETVKQNKPQKVFEKCFMRGRYMLSTVLILLGLCALVA
RAAYVQSINADTLSNEADKRSLRKDEVLSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
ENSLADKERIAALAEELGMTENDLVKKIEKNSKSGYLYLARQVELSKANYIRRLKIKGII
LETEHRRFYPRVEEAAHVVGYTDIDGNGIEGIEKSFNSLLVGKDGSRTVRKDKRGNIVAH
ISDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPS
YNPNNRVGVKSELMRNRAITDTFEPGSTVKPFVVLTALQRGVVKRDEIIDTTSFKLSGKE
IVDVAPRAQQTLDEILMNSSNRGVSRLALRMPPSALMETYQNAGLSKPTDLGLIGEQVGI
LNANRKRWADIERATVAYGYGITATPLQIARAYATLGSFGVYRPLSITKVDPPVIGKRVF
SEKITKDIVGILEKVAIKNKRAMVEGYRVGVKTGTARKIENGHYVNKYVAFTAGIAPISD
PRYALVVLINDPKAGEYYGGAVSAPVFSNIMGYALRANAIPQDAEAAENTTTKSAKRIVY
IGEHKNQKVN



>gb|L42023.1|+|1197840-1199672|Haemophilus influenzae PBP3 conferring resistance to beta-lactam antibiotics [Haemophilus influenzae Rd KW20]
ATGGTGAAATTTAATTCCTCGCGTAAATCAGGTAAGTCAAAAAAAACAATTAGAAAATTGACCGCACCTGAAACTGTAAAGCAAAACAAG
CCTCAAAAGGTGTTTGAAAAATGCTTTATGCGTGGACGTTATATGCTTTCTACGGTTCTTATTTTACTTGGCCTGTGTGCTTTAGTCGCA
CGAGCAGCTTATGTTCAATCTATTAATGCCGATACGTTATCGAATGAAGCGGATAAGCGTTCTTTGCGTAAAGATGAAGTATTATCGGTG
CGTGGTTCTATTTTAGATCGTAATGGTCAGCTTTTATCTGTAAGCGTGCCGATGAGCGCGATTGTGGCAGATCCAAAAACGATGTTGAAG
GAAAATTCGCTTGCGGATAAAGAACGAATTGCAGCTTTAGCCGAAGAATTAGGTATGACTGAAAATGATTTAGTGAAAAAAATTGAGAAA
AATTCTAAATCTGGTTATTTGTATTTAGCACGTCAAGTTGAATTAAGTAAAGCTAACTATATTCGTAGATTAAAAATTAAGGGTATTATT
TTAGAAACAGAGCATCGCCGTTTTTATCCTCGTGTAGAAGAAGCTGCACACGTGGTGGGTTATACGGATATTGATGGAAATGGTATTGAA
GGCATTGAGAAAAGTTTTAATTCCCTGCTTGTTGGTAAAGACGGTTCACGTACTGTTCGTAAAGATAAACGTGGGAATATTGTTGCACAT
ATCTCCGATGAGAAAAAATATGATGCACAAGATGTTACCTTAAGTATCGATGAAAAATTGCAATCTATGGTGTATCGTGAGATTAAAAAG
GCGGTGTCTGAGAATAATGCTGAGTCTGGTACTGCGGTGTTAGTTGATGTTCGAACAGGGGAAGTGTTAGCTATGGCGACTGCGCCCTCT
TATAATCCAAACAACCGTGTCGGCGTGAAATCAGAGTTAATGCGTAACCGTGCAATTACCGATACTTTTGAGCCAGGTTCTACGGTAAAA
CCTTTCGTTGTTTTAACCGCACTTCAACGAGGTGTAGTTAAACGAGATGAAATTATTGATACTACGTCCTTTAAATTAAGCGGTAAAGAA
ATTGTGGACGTTGCACCACGTGCTCAGCAAACTTTAGACGAGATTTTAATGAACTCTAGTAACCGTGGTGTAAGTCGTCTTGCATTACGT
ATGCCACCTAGTGCATTAATGGAAACTTATCAAAATGCAGGTTTAAGTAAACCGACAGATTTAGGCTTGATCGGAGAGCAAGTTGGGATT
TTGAATGCAAATCGTAAACGCTGGGCAGATATTGAGCGTGCAACAGTCGCTTATGGTTATGGTATTACTGCGACACCTTTACAAATTGCT
CGTGCCTATGCAACCCTTGGTAGTTTCGGTGTTTATCGTCCGCTTTCTATCACTAAAGTTGATCCGCCAGTTATTGGGAAACGGGTTTTC
TCTGAAAAAATAACTAAAGATATTGTGGGAATTTTAGAGAAAGTAGCAATTAAAAATAAACGCGCAATGGTGGAAGGCTACCGTGTCGGC
GTAAAAACAGGTACGGCACGTAAGATTGAAAATGGACATTATGTAAATAAGTATGTGGCATTTACTGCGGGTATTGCACCAATTAGTGAT
CCTCGTTATGCATTAGTGGTTTTGATCAATGATCCAAAAGCAGGAGAATATTATGGTGGTGCGGTTTCTGCCCCTGTATTCTCTAACATT
ATGGGCTATGCGTTACGTGCAAATGCTATTCCGCAAGATGCTGAAGCAGCTGAAAACACAACAACGAAAAGTGCAAAACGTATTGTTTAT
ATTGGCGAACACAAGAATCAAAAAGTGAATTAA

Curator Acknowledgements
Curator Description Most Recent Edit