AAC(6')-Im

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3004629
CARD Short Name	AAC(6')-Im
Definition	AAC(6')-Im is an aminoglycoside acetyltransferase encoded by plasmids in E. coli, and E. faecium.
AMR Gene Family	AAC(6')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Campylobacter coli^p, Citrobacter freundii^p, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Enterococcus faecalis^wgs, Enterococcus faecium^p+wgs, Histophilus somni^wgs, Klebsiella pneumoniae^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs
Resistomes with Sequence Variants	Campylobacter coli^p+wgs, Campylobacter jejuni^wgs, Citrobacter freundii^p, Eggerthella lenta^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Enterocloster clostridioformis^wgs, Enterococcus faecalis^wgs, Enterococcus faecium^p+wgs, Histophilus somni^wgs, Klebsiella pneumoniae^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + AAC(6') [AMR Gene Family]
Parent Term(s)	8 ontology terms \| Show + confers_resistance_to_antibiotic dibekacin [Antibiotic] + confers_resistance_to_antibiotic amikacin [Antibiotic] + confers_resistance_to_antibiotic sisomicin [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic] + confers_resistance_to_antibiotic 5-episisomicin [Antibiotic] + AAC(6')-I
Publications	Chow JW, et al. 2001. Antimicrob Agents Chemother 45(10): 2691-2694. Aminoglycoside resistance genes aph(2)-Ib and aac(6')-Im detected together in strains of both Escherichia coli and Enterococcus faecium. (PMID 11557456)

Resistomes

Prevalence of AAC(6')-Im among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Campylobacter coli	0%	0.91%	0.53%	0%	0%
Campylobacter coli	0%	0.91%	0%	0%	0%
Campylobacter jejuni	0%	0%	0%	0%	0%
Campylobacter jejuni	0%	0%	0.09%	0%	0%
Citrobacter freundii	0%	0.31%	0%	0%	0%
Citrobacter freundii	0%	0.31%	0%	0%	0%
Eggerthella lenta	0%	0%	0%	0%	0%
Eggerthella lenta	0%	0%	1.04%	0%	0%
Enterobacter hormaechei	0%	0%	0.13%	0%	0%
Enterobacter hormaechei	0%	0%	0.13%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterocloster clostridioformis	0%	0%	0%	0%	0%
Enterocloster clostridioformis	0%	0%	4.65%	0%	0%
Enterococcus faecalis	0%	0%	0.04%	0%	0%
Enterococcus faecalis	0%	0%	0.04%	0%	0%
Enterococcus faecium	0%	0.06%	0.07%	0%	0%
Enterococcus faecium	0%	0.06%	0.07%	0%	0%
Histophilus somni	0%	0%	3.45%	0%	0%
Histophilus somni	0%	0%	3.45%	0%	0%
Klebsiella pneumoniae	0%	0.03%	0.21%	0%	0%
Klebsiella pneumoniae	0%	0.03%	0.21%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275

Protein
DNA

>gb|AAK63041.1|+|AAC(6')-Im [Escherichia coli]
MLEKKRVSFRPMNEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGELFDEYNYHET
EEKIYAMDQFIGEPEYWNMGIGAEYCRVVCQYLRTEMDADAVILDPRKNNLRAVRAYQKAGFKIIKELPEHELHEGKKEDCVLMEWRV

>gb|AF337947.1|+|1215-1751|AAC(6')-Im [Escherichia coli]
ATGTTGGAAAAAAAGCGAGTTTCCTTTCGCCCGATGAATGAGGATGATTTAGTTCTAATGTTAAAATGGCTGACAGATGACCGTGTTCTT
GAATTCTACGACGGTAGAGATAAAAAACATACACAGAAAACGATTCGTGAGCATTATACAGAGCAATGGGCGGATGAGATTTATCGAGTC
ATCATTGAATATGATACAATTCCTATCGGTTACGCACAAATATATAGAATTCAGGGGGAACTTTTCGACGAATATAATTACCATGAGACG
GAAGAAAAGATTTATGCGATGGACCAATTTATCGGTGAGCCGGAATATTGGAATATGGGAATCGGTGCAGAATATTGCAGAGTAGTATGC
CAATATCTACGAACGGAAATGGATGCCGATGCGGTGATTCTTGACCCACGAAAAAATAATCTACGAGCAGTACGAGCATATCAGAAGGCA
GGATTTAAAATAATTAAGGAACTTCCCGAACATGAGCTACACGAGGGGAAAAAGGAAGATTGTGTGCTGATGGAATGGAGAGTGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(6')-Im

Prevalence: protein homolog model (view sequences)

Graph