AAC(6')-Il

Accession ARO:3004635
Synonym(s)aacA7
DefinitionAAC(6')-Il is an aminoglycoside acetyltransferase encoded by plasmids and integrons in Enterobacter cloaecae and Klebsiella aerogenes
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter youngaewgs, Enterobacter cloacaep, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Pseudomonas stutzeriwgs, Raoultella planticolawgs, Salmonella entericap+wgs, Serratia marcescenswgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter youngaewgs, Enterobacter cloacaep, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Pseudomonas stutzeriwgs, Raoultella planticolawgs, Salmonella entericap+wgs, Serratia marcescenswgs
Classification19 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ AAC(6') [AMR Gene Family]
Publications

Bunny KL, et al. 1995. Antimicrob Agents Chemother 39(3): 686-693. New mobile gene cassettes containing an aminoglycoside resistance gene, aacA7, and a chloramphenicol resistance gene, catB3, in an integron in pBWH301. (PMID 7793874)

Resistomes

Prevalence of AAC(6')-Il among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.02%
Citrobacter youngae0%0%12.5%
Enterobacter cloacae0%1.15%0%
Enterobacter hormaechei0%2.75%0.86%
Escherichia coli0%0.04%0.13%
Klebsiella oxytoca0%1.67%0%
Klebsiella pneumoniae0%0.14%0.54%
Providencia rettgeri0%20%6.25%
Providencia stuartii0%0%4.17%
Pseudomonas aeruginosa0%1.92%2.08%
Pseudomonas fluorescens0%0%0%
Pseudomonas stutzeri0%0%6.94%
Raoultella planticola0%0%3.57%
Salmonella enterica0%0.18%0.01%
Serratia marcescens0%0%0.36%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|AAA90937.1|+|AAC(6')-Il [Klebsiella aerogenes] Partial
MDSSPLVRPVETTDSASWLSMRCELWPDGTCQEHQSEIAEFLSGKVARPAAVLIAVAPDGEALGFAELSIRPYAEECYSGNVAFLEGWYV
VPSARRQGVGVALVKAAEHWARGRGCTEFASDTQLTNSASTSAHLAAGFTEVAQVRCFRKPL


>gb|U13880.2|+|309-767|AAC(6')-Il [Klebsiella aerogenes] Partial
ATGGATAGTTCGCCGCTCGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAGCTGTGGCCAGATGGCACA
TGTCAAGAGCACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGCTGCTGTCCTCATTGCTGTAGCACCCGACGGA
GAAGCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGGAGTGCTACTCCGGCAACGTTGCGTTCTTGGAGGGTTGGTACGTT
GTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTAGCTCTGGTAAAAGCCGCCGAGCATTGGGCTCGTGGTCGCGGATGCACCGAATTCGCC
TCCGACACTCAACTTACCAACAGCGCAAGCACCTCGGCGCACCTGGCGGCTGGATTCACGGAGGTTGCTCAAGTACGCTGCTTCCGGAAA
CCGTTGTGA