AAC(6')-Il

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004635
Synonym(s)aacA7
CARD Short NameAAC(6')-Il
DefinitionAAC(6')-Il is an aminoglycoside acetyltransferase encoded by plasmids and integrons in Enterobacter cloaecae and Klebsiella aerogenes.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (3), Enterobacter cloacae (2), Pseudomonas aeruginosa (2)
GAZ
FOODON
ENVO
UBERON
Classification11 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ AAC(6')-I
Resistomes with Perfect MatchesAlcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescenswgs, Shewanella putrefaciensp, Stutzerimonas stutzeriwgs
Resistomes with Sequence VariantsAeromonas hydrophilawgs, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosap+wgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescenswgs, Shewanella putrefaciensp, Stutzerimonas stutzeriwgs
Publications

Bunny KL, et al. 1995. Antimicrob Agents Chemother 39(3): 686-693. New mobile gene cassettes containing an aminoglycoside resistance gene, aacA7, and a chloramphenicol resistance gene, catB3, in an integron in pBWH301. (PMID 7793874)

Resistomes

Prevalence of AAC(6')-Il among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas hydrophila0%0%0.81%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0%0.19%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter cloacae0%0%8.95%0%0%
Enterobacter hormaechei0%0.77%1.77%0%0%
Escherichia coli0%0.03%0.16%0%0%
Klebsiella pneumoniae0%0.16%0.48%0%0%
Klebsiella quasipneumoniae0%0.85%0.79%0%0%
Proteus mirabilis0%0%0.33%0%0%
Providencia rettgeri0%2.7%1.27%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0%1.75%2.75%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0%0.52%0%0%
Shewanella putrefaciens0%20%0%0%0%
Stutzerimonas stutzeri0%0%5.34%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|AAA90937.1|+|AAC(6')-Il [Klebsiella aerogenes]
MDSSPLVRPVETTDSASWLSMRCELWPDGTCQEHQSEIAEFLSGKVARPAAVLIAVAPDGEALGFAELSIRPYAEECYSGNVAFLEGWYV
VPSARRQGVGVALVKAAEHWARGRGCTEFASDTQLTNSASTSAHLAAGFTEVAQVRCFRKPL


>gb|U13880.2|+|309-767|AAC(6')-Il [Klebsiella aerogenes]
ATGGATAGTTCGCCGCTCGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAGCTGTGGCCAGATGGCACA
TGTCAAGAGCACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGCTGCTGTCCTCATTGCTGTAGCACCCGACGGA
GAAGCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGGAGTGCTACTCCGGCAACGTTGCGTTCTTGGAGGGTTGGTACGTT
GTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTAGCTCTGGTAAAAGCCGCCGAGCATTGGGCTCGTGGTCGCGGATGCACCGAATTCGCC
TCCGACACTCAACTTACCAACAGCGCAAGCACCTCGGCGCACCTGGCGGCTGGATTCACGGAGGTTGCTCAAGTACGCTGCTTCCGGAAA
CCGTTGTGA

Curator Acknowledgements
Curator Description Most Recent Edit