AAC(6')-Iag

Accession ARO:3004638
Synonym(s)aacA48
DefinitionAAC(6')-Iag is an aminoglycoside acetyltransferase encoded by integrons in Pseudomonas aeruginosa
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification20 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
Publications

Kobayashi K, et al. 2013. PLoS ONE 8(8):e70557 Identification and characterization of a novel aac(6')-Iag associated with the blaIMP-1-integron in a multidrug-resistant Pseudomonas aeruginosa. (PMID 23950962)

Resistomes

Prevalence of AAC(6')-Iag among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|BAN78519.1|+|AAC(6')-Iag [Pseudomonas aeruginosa]
MSKLGPTKPAPSMANTPVGNVVPCKTPDHPGWLELRLQLWPDGSTEEFLPEMAAACAEPDRFGQFLFLSPGGLAEGLVEVALRTDYVNGT
ESSPVAFLEGVFVVPASRGLGIARALVAAAEGWARDRGCTEFASDAEVSNVGSHAMHAALGFVETERVVFFRKVVAP


>gb|AB472901.2|+|1186-1689|AAC(6')-Iag [Pseudomonas aeruginosa]
ATGAGCAAGTTAGGTCCCACTAAACCTGCACCGAGCATGGCGAACACTCCGGTTGGAAACGTCGTGCCATGCAAGACGCCAGATCACCCT
GGCTGGCTTGAGTTGCGCCTGCAGCTGTGGCCAGATGGCTCAACCGAGGAGTTCCTTCCCGAGATGGCTGCGGCCTGCGCTGAACCCGAC
CGCTTCGGCCAGTTTTTGTTCCTGTCGCCGGGCGGCTTGGCGGAGGGCCTGGTCGAGGTGGCGCTTCGCACGGACTACGTCAACGGCACC
GAAAGCTCGCCAGTCGCCTTTCTCGAAGGCGTCTTCGTGGTGCCAGCGAGTCGAGGCCTTGGCATCGCCAGAGCGCTGGTGGCTGCGGCG
GAAGGCTGGGCTAGAGATCGTGGCTGCACTGAGTTCGCCTCGGACGCCGAGGTCAGCAACGTTGGTAGTCACGCCATGCACGCCGCTCTT
GGTTTCGTCGAAACTGAGCGCGTCGTGTTCTTCCGTAAGGTCGTGGCACCGTGA