AAC(6')-Iap

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3007204
CARD Short NameAAC(6')-Iap
DefinitionAAC(6')-Iap is an aminoglycoside acetyltransferase that confers resistance to a number of aminoglycoside antibiotics.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 5-episisomicin [Antibiotic]
+ AAC(6')-I
Resistomes with Perfect MatchesStenotrophomonas maltophiliag
Resistomes with Sequence VariantsStenotrophomonas maltophiliag+wgs
Publications

Kawauchi R, et al. 2022. Microbiol Spectr :e0114322 Stenotrophomonas maltophilia from Nepal Producing Two Novel Antibiotic Inactivating Enzymes, a Class A β-Lactamase KBL-1 and an Aminoglycoside 6'-N-Acetyltransferase AAC(6')-Iap. (PMID 35862995)

Resistomes

Prevalence of AAC(6')-Iap among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Stenotrophomonas maltophilia4.49%0%1.93%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|BCD41405.1|+|AAC(6')-Iap [Stenotrophomonas maltophilia]
MSGCAATIRQATPADAAAWSQLRVGLWPDADDPLEELAQSLADPEGAVFLACAADGEAVGFAEVRLRHDYVNGTGSSPVGFLEGWYVTPQ
WQGRAVGRALLAEVQAWTRDAGCSELASDSRLEDLEAHAAHRACGFVETERVVYFRMPLDAVTRG


>gb|LC536747.1|+|1-468|AAC(6')-Iap [Stenotrophomonas maltophilia]
GTGAGCGGCTGCGCTGCCACGATCCGCCAGGCCACACCGGCCGATGCCGCTGCATGGTCGCAGCTGCGCGTGGGCCTGTGGCCCGACGCC
GATGATCCACTGGAGGAGCTGGCGCAGTCGCTGGCCGATCCGGAAGGTGCGGTGTTCCTGGCGTGCGCGGCTGATGGTGAGGCGGTCGGT
TTCGCTGAGGTACGCCTGCGCCACGACTATGTGAACGGCACCGGTTCCTCGCCGGTCGGGTTCCTGGAAGGCTGGTATGTAACGCCGCAG
TGGCAGGGCCGCGCTGTCGGCCGTGCCCTGCTGGCGGAAGTGCAGGCGTGGACGCGGGACGCGGGCTGCAGCGAGCTGGCCTCGGACAGC
CGCCTGGAGGACTTAGAGGCGCACGCGGCACACCGCGCCTGTGGCTTTGTAGAGACCGAGCGGGTGGTCTATTTCCGCATGCCGCTGGAC
GCGGTCACGCGGGGGTAG

Curator Acknowledgements
Curator Description Most Recent Edit