Escherichia coli PBP3 mutants conferring resistance to beta-lactam antibiotics

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3007423
CARD Short NameEcol_PBP3_BLA
DefinitionMutant PBP3 in E. coli conferring resistance to beta-lactams, including beta-lactam/beta-lactamase inhibitor combinations.
AMR Gene FamilyOXA-1-like beta-lactamase, class A Mycobacterium abscessus beta-lactamase, MOX beta-lactamase, ACT beta-lactamase, CMY beta-lactamase, KPC beta-lactamase, IMP beta-lactamase, CTX-M beta-lactamase, SHV beta-lactamase, TEM beta-lactamase, penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics
Drug Classpenicillin beta-lactam, azole antibiotic, cephalosporin, imidazole antibiotic, carbapenem, monobactam
Resistance Mechanismantibiotic inactivation, antibiotic target alteration
Classification136 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ mechanism of antibiotic resistance
+ determinant of antibiotic resistance
+ antibiotic molecule
+ antibiotic inactivation [Resistance Mechanism]
+ antibiotic inactivation enzyme
+ hydrolysis of antibiotic conferring resistance
+ beta-lactam antibiotic
+ hydrolysis of beta-lactam antibiotic by serine beta-lactamase
+ penicillin beta-lactam [Drug Class]
+ beta-lactamase
+ beta-lactamase resistant penicillin
+ hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase
+ class C beta-lactamase
+ resistance-modifying agents
+ penicillin with extended spectrum
+ azole antibiotic [Drug Class]
+ inhibitor of antibiotic resistance mechanism
+ CMY-LAT-MOX beta-lactamase
+ class A beta-lactamase
+ class D beta-lactamase
+ class B (metallo-) beta-lactamase
+ oxacillin [Antibiotic]
+ cephalosporin [Drug Class]
+ beta-lactamase sensitive penicillin
+ other cephalosporins and penems
+ fourth-generation cephalosporin [Drug Subclass]
+ third-generation cephalosporin [Drug Subclass]
+ second-generation cephalosporin [Drug Subclass]
+ first-generation cephalosporin [Drug Subclass]
+ imidazole antibiotic [Drug Class]
+ antibiotic target
+ ampicillin [Antibiotic]
+ subclass B1 (metallo-) beta-lactamase
+ SHV-LEN beta-lactamase
+ CMY-MOX beta-lactamase
+ CMY-LAT beta-lactamase
+ beta-lactamase inhibitor
+ OXA beta-lactamase
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ OXA-1-like beta-lactamase [AMR Gene Family]
+ class A Mycobacterium abscessus beta-lactamase [AMR Gene Family]
+ serine beta-lactamase inhibitor
+ moxalactam [Antibiotic]
+ loracarbef [Antibiotic]
+ cefradine [Antibiotic]
+ cephapirin [Antibiotic]
+ ceftizoxime [Antibiotic]
+ ceftiofur [Antibiotic]
+ cefprozil [Antibiotic]
+ cefonicid [Antibiotic]
+ cefmetazole [Antibiotic]
+ ticarcillin [Antibiotic]
+ mecillinam [Antibiotic]
+ cell wall synthesis enzyme targeted by antibiotic
+ cefalotin [Antibiotic]
+ ceftaroline [Antibiotic]
+ cefdinir [Antibiotic]
+ cefditoren [Antibiotic]
+ ceftibuten [Antibiotic]
+ cefpodoxime [Antibiotic]
+ cefixime [Antibiotic]
+ cefotaxime [Antibiotic]
+ cefaclor [Antibiotic]
+ cefotiam [Antibiotic]
+ cefadroxil [Antibiotic]
+ cefalexin [Antibiotic]
+ doripenem [Antibiotic]
+ mezlocillin [Antibiotic]
+ azlocillin [Antibiotic]
+ flucloxacillin [Antibiotic]
+ dicloxacillin [Antibiotic]
+ propicillin [Antibiotic]
+ phenoxymethylpenicillin [Antibiotic]
+ benzylpenicillin [Antibiotic]
+ aztreonam [Antibiotic]
+ imipenem [Antibiotic]
+ MOX beta-lactamase [AMR Gene Family]
+ ACT beta-lactamase [AMR Gene Family]
+ CMY beta-lactamase [AMR Gene Family]
+ KPC beta-lactamase [AMR Gene Family]
+ IMP beta-lactamase [AMR Gene Family]
+ CTX-M beta-lactamase [AMR Gene Family]
+ SHV beta-lactamase [AMR Gene Family]
+ TEM beta-lactamase [AMR Gene Family]
+ antibiotic target alteration [Resistance Mechanism]
+ piperacillin [Antibiotic]
+ meropenem [Antibiotic]
+ ertapenem [Antibiotic]
+ amoxicillin [Antibiotic]
+ cefuroxime [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftobiprole [Antibiotic]
+ ceftazidime [Antibiotic]
+ cefepime [Antibiotic]
+ cefazolin [Antibiotic]
+ carbenicillin [Antibiotic]
+ methicillin [Antibiotic]
+ cloxacillin [Antibiotic]
+ cefoxitin [Antibiotic]
+ MAB
+ diazabicyclooctane
+ KPC-3
+ KPC-2
+ IMP-4
+ MOX-1
+ CMY-8
+ CTX-M-65
+ CTX-M-55
+ CTX-M-27
+ CTX-M-24
+ CTX-M-15
+ ACT-1
+ OXA-1
+ SHV-52
+ SHV-18
+ SHV-7
+ SHV-4
+ SHV-3
+ SHV-2
+ SHV-1
+ TEM-71
+ TEM-28
+ TEM-26
+ TEM-12
+ TEM-10
+ TEM-9
+ TEM-3
+ TEM-1
+ beta-lactam sensitive penicillin-binding protein
+ mutation conferring antibiotic resistance
+ beta-lactam resistant penicillin-binding proteins
+ antibiotic mixture
+ avibactam [Adjuvant]
+ antibiotic resistance gene variant or mutant
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic avibactam [Adjuvant]
+ confers_resistance_to_antibiotic ceftaroline [Antibiotic]
+ penicillin-binding protein with mutation conferring resistance to beta-lactam antibiotics [AMR Gene Family]
+ confers_resistance_to_antibiotic aztreonam-avibactam [Antibiotic+Adjuvant]
Publications

Zhang Y, et al. 2017. Antimicrob Agents Chemother 61(8): Unusual Escherichia coli PBP 3 Insertion Sequence Identified from a Collection of Carbapenem-Resistant Enterobacteriaceae Tested In Vitro with a Combination of Ceftazidime-, Ceftaroline-, or Aztreonam-Avibactam. (PMID 28559260)

Alm RA, et al. 2015. J Antimicrob Chemother 70(5):1420-8 Characterization of Escherichia coli NDM isolates with decreased susceptibility to aztreonam/avibactam: role of a novel insertion in PBP3. (PMID 25634992)

Fabrizio C, et al. 2026. Antimicrob Agents Chemother 70(5):e0088725 Optimizing target inactivation to treat multidrug-resistant Escherichia coli with NDM and PBP3 mutations: going the extra mile. (PMID 41718487)

Resistomes

Prevalence of Escherichia coli PBP3 mutants conferring resistance to beta-lactam antibiotics among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 1100

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
N330_R335insTIPYinsertion mutation from peptide sequencePMID:28559260

>gb|CAA38861.1|+|Escherichia coli PBP3 mutants conferring resistance to beta-lactam antibiotics [Escherichia coli str. K-12 substr. W3110]
MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS



>gb|X55034.1|+|7943-9709|Escherichia coli PBP3 mutants conferring resistance to beta-lactam antibiotics [Escherichia coli str. K-12 substr. W3110]
ATGAAAGCAGCGGCGAAAACGCAGAAACCAAAACGTCAGGAAGAACATGCCAACTTTATCAGTTGGCGTTTTGCGTTGTTATGCGGCTGT
ATTCTCCTGGCGCTGGCTTTTCTGCTCGGACGCGTAGCGTGGTTACAAGTTATCTCCCCGGATATGCTGGTGAAAGAGGGCGACATGCGT
TCTCTTCGCGTTCAGCAAGTTTCCACCTCCCGCGGCATGATTACTGACCGTTCTGGTCGCCCGTTAGCGGTGAGCGTGCCGGTAAAAGCG
ATTTGGGCTGACCCGAAAGAAGTGCATGACGCTGGCGGTATCAGCGTCGGTGACCGCTGGAAGGCGCTGGCTAACGCGCTCAATATTCCG
CTGGATCAGCTTTCAGCCCGCATTAACGCCAACCCGAAAGGGCGCTTTATTTATCTGGCGCGTCAGGTGAACCCTGACATGGCGGACTAC
ATCAAAAAACTGAAACTGCCGGGGATTCATCTGCGTGAAGAGTCTCGCCGTTACTATCCGTCCGGCGAAGTGACTGCTCACCTCATCGGC
TTTACTAACGTCGATAGTCAAGGGATTGAGGGCGTTGAGAAGAGTTTCGATAAATGGCTTACCGGGCAGCCGGGTGAGCGCATTGTGCGT
AAAGACCGCTATGGTCGCGTAATTGAAGATATTTCTTCTACTGACAGCCAGGCAGCGCACAACCTGGCGCTGAGTATTGATGAACGCCTG
CAGGCGCTGGTTTATCGCGAACTGAACAACGCGGTGGCCTTTAACAAGGCTGAATCTGGTAGCGCCGTGCTGGTGGATGTCAACACCGGT
GAAGTGCTGGCGATGGCTAACAGCCCGTCATACAACCCTAACAATCTGAGCGGCACGCCGAAAGAGGCGATGCGTAACCGTACCATCACC
GACGTGTTTGAACCGGGCTCAACGGTTAAACCGATGGTGGTAATGACCGCGTTGCAACGTGGCGTGGTGCGGGAAAACTCGGTACTCAAT
ACCATTCCTTATCGAATTAACGGCCACGAAATCAAAGACGTGGCACGCTACAGCGAATTAACCCTGACCGGGGTATTACAGAAGTCGAGT
AACGTCGGTGTTTCCAAGCTGGCGTTAGCGATGCCGTCCTCAGCGTTAGTAGATACTTACTCACGTTTTGGACTGGGAAAAGCGACCAAT
TTGGGGTTGGTCGGAGAACGCAGTGGCTTATATCCTCAAAAACAACGGTGGTCTGACATAGAGAGGGCCACCTTCTCTTTCGGCTACGGG
CTAATGGTAACACCATTACAGTTAGCGCGAGTCTACGCAACTATCGGCAGCTACGGCATTTATCGCCCACTGTCGATTACCAAAGTTGAC
CCCCCGGTTCCCGGTGAACGTGTCTTCCCGGAATCCATTGTCCGCACTGTGGTGCATATGATGGAAAGCGTGGCGCTACCAGGCGGCGGC
GGCGTGAAGGCGGCGATTAAAGGCTATCGTATCGCCATTAAAACCGGTACCGCGAAAAAGGTCGGGCCGGACGGTCGCTACATCAATAAA
TATATTGCTTATACCGCAGGCGTTGCGCCTGCGAGTCAGCCGCGCTTCGCGCTGGTTGTTGTTATCAACGATCCGCAGGCGGGTAAATAC
TACGGCGGCGCCGTTTCCGCGCCGGTCTTTGGTGCCATCATGGGCGGCGTATTGCGTACCATGAACATCGAGCCGGATGCGCTGACAACG
GGCGATAAAAATGAATTTGTGATTAATCAAGGCGAGGGGACAGGTGGCAGATCGTAA

Curator Acknowledgements
Curator Description Most Recent Edit