almF

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3007431
CARD Short NamealmF
DefinitionalmF is a glycine carrier protein associated with the almEFG operon in Vibrio cholerae. It is activated by almE and carries the glycyl molecule later added to lipid A by almG.
AMR Gene Familypolymyxin resistance operon, alm glycyl carrier protein
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics
Resistance Mechanismantibiotic target alteration
Classification17 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ alm glycyl carrier protein [AMR Gene Family]
+ part_of almEFG
Resistomes with Perfect MatchesVibrio choleraeg+wgs, Vibrio metoecusg+wgs
Resistomes with Sequence VariantsKlebsiella pneumoniaewgs, Vibrio choleraeg+wgs, Vibrio metoecusg+wgs
Publications

Henderson JC, et al. 2014. ACS Chem Biol 9(10):2382-92 Antimicrobial peptide resistance of Vibrio cholerae results from an LPS modification pathway related to nonribosomal peptide synthetases. (PMID 25068415)

Resistomes

Prevalence of almF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Klebsiella pneumoniae0%0%0.01%0%0%
Vibrio cholerae48.88%0%96.81%0%0%
Vibrio metoecus50%0%96%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 125


>gb|PNM48229.1|-|almF [Vibrio cholerae]
MKQAIENILIERLQTSIEGISSILTNKFFDEFDSFSFIDIVAKVESQFSAQINLFDMPLTMESSVNEVIDWLVSEVGE


>gb|LOSL02000001.1|-|267460-267696|almF [Vibrio cholerae]
ATGAAACAAGCCATTGAAAATATTCTTATTGAGCGATTACAAACCAGTATTGAGGGTATTTCATCGATACTCACCAATAAATTTTTCGAT
GAGTTTGATTCCTTCTCTTTCATCGATATTGTCGCCAAAGTAGAAAGCCAGTTTTCGGCACAAATTAATCTATTTGATATGCCATTAACC
ATGGAATCGTCAGTCAATGAAGTCATTGATTGGTTAGTGAGCGAAGTAGGGGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit