Neisseria gonorrhoeae porin PIB (por)

Accession ARO:3000464
CARD Short NameNgon_porin
DefinitionMutant forms of the porin Por result in reduced permeability to antibiotics, particularly tetracyclines and beta-lactams.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classcarbapenem, penam, cephalosporin, cephamycin, monobactam, tetracycline antibiotic, penem
Resistance Mechanismreduced permeability to antibiotic
Resistomes with Sequence VariantsNeisseria gonorrhoeaeg+wgs
Classification16 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
+ confers_resistance_to_antibiotic penicillin [Antibiotic]
Publications

Gill MJ, et al. 1998. Antimicrob Agents Chemother 42(11): 2799-2803. Gonococcal resistance to beta-lactams and tetracycline involves mutation in loop 3 of the porin encoded at the penB locus. (PMID 9797206)

Olesky M, et al. 2002. Antimicrob Agents Chemother 46(9): 2811-2820. Identification and analysis of amino acid mutations in porin IB that mediate intermediate-level resistance to penicillin and tetracycline in Neisseria gonorrhoeae. (PMID 12183233)

Olesky M, et al. 2006. J Bacteriol 188(7): 2300-2308. Porin-mediated antibiotic resistance in Neisseria gonorrhoeae: ion, solute, and antibiotic permeation through PIB proteins with penB mutations. (PMID 16547016)

Resistomes

Prevalence of Neisseria gonorrhoeae porin PIB (por) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Neisseria gonorrhoeae40.62%0%44.11%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 600

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:

PMID: 12183233G120D G120K G120P,A121P G120R,A121H A121D

>gb|AAB57788.1|+|Neisseria gonorrhoeae porin PIB (por) [Neisseria gonorrhoeae]
MKKSLIALTLAALPVAATADVTLYGAIKAGVQTYRSVEHTKGKVSKVETGSEIADFGSKI
GFKGQEDLGNGLKAVWQLEQGASVAGTNTGWGNKQSFVGLKGGFGTIRAGSLNSPLKNTG
ANVNAWESGKFTGNVLEISGMAQREHRYLSVRYDSPEFAGFSGSVQYAPKDNSGSNGESY
HVGLNYRNNGFFAQYAGLFQRYGEGTKKIEYEHQVYSIPSLFVEKLQVHRLVGGYDNNAL
YVSVAAQQQDAKLYGARRANSHNSQTEVAATAAYRFGNVTPRVSYAHGFKGTVDSADHDN
TYDQVVVGAEYDFSKRTSALVSAGWLQEGKGADKIVSTASAVVLRHKF



>gb|U75641.1|+|20-1066|Neisseria gonorrhoeae porin PIB (por) [Neisseria gonorrhoeae]
ATGAAAAAATCCCTGATTGCCCTGACTTTGGCAGCCCTTCCTGTTGCGGCAACGGCCGATGTCACCCTGTACGGCGCCATCAAAGCCGGC
GTACAAACTTACCGTTCTGTAGAACATACAAAAGGCAAGGTAAGTAAAGTGGAAACCGGCAGCGAAATCGCCGACTTCGGTTCAAAAATC
GGCTTCAAAGGCCAAGAAGACCTCGGCAACGGCCTGAAGGCCGTTTGGCAGTTGGAACAAGGTGCCTCCGTCGCCGGCACTAACACCGGC
TGGGGCAACAAACAATCCTTCGTCGGCTTGAAGGGCGGCTTCGGTACCATCCGCGCCGGTAGCCTGAACAGCCCCCTGAAAAACACCGGC
GCCAACGTCAATGCTTGGGAATCCGGCAAATTTACCGGCAATGTGCTGGAAATCAGCGGAATGGCCCAACGGGAACACCGCTACCTGTCC
GTACGCTACGATTCTCCCGAATTTGCCGGCTTCAGCGGCAGCGTACAATACGCACCTAAAGACAATTCAGGCTCAAACGGCGAATCTTAC
CACGTTGGTTTGAACTACCGAAACAACGGCTTCTTCGCACAATACGCCGGCTTGTTCCAAAGATACGGCGAAGGCACTAAAAAAATCGAA
TACGAACATCAAGTTTATAGTATCCCCAGCCTGTTTGTTGAAAAACTGCAAGTTCACCGTTTGGTAGGCGGTTACGACAATAATGCCCTG
TACGTTTCCGTAGCCGCGCAACAACAAGATGCCAAATTGTATGGAGCAAGGAGGGCTAATTCGCACAACTCTCAAACCGAAGTTGCCGCT
ACCGCGGCATACCGTTTCGGCAATGTAACGCCCCGCGTTTCTTACGCCCACGGCTTCAAAGGCACTGTTGATAGTGCAGACCACGACAAT
ACTTATGACCAAGTGGTTGTCGGTGCGGAATACGACTTCTCCAAACGCACTTCTGCCTTGGTTTCTGCCGGCTGGTTGCAAGAAGGCAAA
GGCGCAGACAAAATCGTATCGACTGCCAGCGCCGTCGTTCTGCGCCACAAATTCTAA