Neisseria gonorrhoeae porin PIB (por)

Accession ARO:3000464
DefinitionMutant forms of the porin Por result in reduced permeability to antibiotics, particularly tetracyclines and beta-lactams.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenem, penam, tetracycline antibiotic, cephamycin, carbapenem, monobactam, cephalosporin
Resistance Mechanismreduced permeability to antibiotic
Classification17 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Gill MJ, et al. 1998. Antimicrob Agents Chemother 42(11): 2799-2803. Gonococcal resistance to beta-lactams and tetracycline involves mutation in loop 3 of the porin encoded at the penB locus. (PMID 9797206)

Olesky M, et al. 2002. Antimicrob Agents Chemother 46(9): 2811-2820. Identification and analysis of amino acid mutations in porin IB that mediate intermediate-level resistance to penicillin and tetracycline in Neisseria gonorrhoeae. (PMID 12183233)

Olesky M, et al. 2006. J Bacteriol 188(7): 2300-2308. Porin-mediated antibiotic resistance in Neisseria gonorrhoeae: ion, solute, and antibiotic permeation through PIB proteins with penB mutations. (PMID 16547016)

Resistomes

Prevalence of Neisseria gonorrhoeae porin PIB (por) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Neisseria gonorrhoeae71.79%0%57.56%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 600

PMID: 12183233G120D G120K G120P,A121P G120R,A121H A121D

>gb|AAB57788.1|+|Neisseria gonorrhoeae mutant porin PIB (por) with reduced permeability to antibiotic [Neisseria gonorrhoeae]
MKKSLIALTLAALPVAATADVTLYGAIKAGVQTYRSVEHTKGKVSKVETGSEIADFGSKI
GFKGQEDLGNGLKAVWQLEQGASVAGTNTGWGNKQSFVGLKGGFGTIRAGSLNSPLKNTG
ANVNAWESGKFTGNVLEISGMAQREHRYLSVRYDSPEFAGFSGSVQYAPKDNSGSNGESY
HVGLNYRNNGFFAQYAGLFQRYGEGTKKIEYEHQVYSIPSLFVEKLQVHRLVGGYDNNAL
YVSVAAQQQDAKLYGARRANSHNSQTEVAATAAYRFGNVTPRVSYAHGFKGTVDSADHDN
TYDQVVVGAEYDFSKRTSALVSAGWLQEGKGADKIVSTASAVVLRHKF



>gb|U75641|+|20-1066|Neisseria gonorrhoeae mutant porin PIB (por) with reduced permeability to antibiotic [Neisseria gonorrhoeae]
ATGAAAAAATCCCTGATTGCCCTGACTTTGGCAGCCCTTCCTGTTGCGGCAACGGCCGATGTCACCCTGTACGGCGCCATCAAAGCCGGC
GTACAAACTTACCGTTCTGTAGAACATACAAAAGGCAAGGTAAGTAAAGTGGAAACCGGCAGCGAAATCGCCGACTTCGGTTCAAAAATC
GGCTTCAAAGGCCAAGAAGACCTCGGCAACGGCCTGAAGGCCGTTTGGCAGTTGGAACAAGGTGCCTCCGTCGCCGGCACTAACACCGGC
TGGGGCAACAAACAATCCTTCGTCGGCTTGAAGGGCGGCTTCGGTACCATCCGCGCCGGTAGCCTGAACAGCCCCCTGAAAAACACCGGC
GCCAACGTCAATGCTTGGGAATCCGGCAAATTTACCGGCAATGTGCTGGAAATCAGCGGAATGGCCCAACGGGAACACCGCTACCTGTCC
GTACGCTACGATTCTCCCGAATTTGCCGGCTTCAGCGGCAGCGTACAATACGCACCTAAAGACAATTCAGGCTCAAACGGCGAATCTTAC
CACGTTGGTTTGAACTACCGAAACAACGGCTTCTTCGCACAATACGCCGGCTTGTTCCAAAGATACGGCGAAGGCACTAAAAAAATCGAA
TACGAACATCAAGTTTATAGTATCCCCAGCCTGTTTGTTGAAAAACTGCAAGTTCACCGTTTGGTAGGCGGTTACGACAATAATGCCCTG
TACGTTTCCGTAGCCGCGCAACAACAAGATGCCAAATTGTATGGAGCAAGGAGGGCTAATTCGCACAACTCTCAAACCGAAGTTGCCGCT
ACCGCGGCATACCGTTTCGGCAATGTAACGCCCCGCGTTTCTTACGCCCACGGCTTCAAAGGCACTGTTGATAGTGCAGACCACGACAAT
ACTTATGACCAAGTGGTTGTCGGTGCGGAATACGACTTCTCCAAACGCACTTCTGCCTTGGTTTCTGCCGGCTGGTTGCAAGAAGGCAAA
GGCGCAGACAAAATCGTATCGACTGCCAGCGCCGTCGTTCTGCGCCACAAATTCTAA