MexS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000813
Synonym(s)nfxC PA2491 qrh
CARD Short NameMexS
DefinitionMexS is a suppressor of MexT, which is an activator of the multidrug pump MexEF-OprN. Mutations in MexS lead to multidrug resistance.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classphenicol antibiotic, diaminopyrimidine antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (15)
GAZ
FOODON
ENVO
UBERONmembrane organ (4)
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Resistomes with Sequence VariantsPseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensg
Publications

Maseda H, et al. 2000. FEMS Microbiol Lett 192(1): 107-112. Variation of the mexT gene, a regulator of the MexEF-oprN efflux pump expression in wild-type strains of Pseudomonas aeruginosa. (PMID 11040437)

Sobel ML, et al. 2005. J Bacteriol 187(4): 1246-1253. Mutations in PA2491 (mexS) promote MexT-dependent mexEF-oprN expression and multidrug resistance in a clinical strain of Pseudomonas aeruginosa. (PMID 15687188)

Richardot C, et al. 2016. Antimicrob. Agents Chemother. 60(4):2302-10 Amino Acid Substitutions Account for Most MexS Alterations in Clinical nfxC Mutants of Pseudomonas aeruginosa. (PMID 26833155)

Resistomes

Prevalence of MexS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Pseudomonas aeruginosa96.78%0.29%94.76%0%0%
Pseudomonas fluorescens2.78%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 660

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
D44Esingle resistance variantPMID:26833155
S60Fsingle resistance variantPMID:26833155
S60Psingle resistance variantPMID:26833155
V73Asingle resistance variantPMID:26833155
V104Asingle resistance variantPMID:26833155
A166Psingle resistance variantPMID:26833155
F185Lsingle resistance variantPMID:26833155
C245Gsingle resistance variantPMID:26833155
F253Lsingle resistance variantPMID:26833155
L263Qsingle resistance variantPMID:26833155
L270Qsingle resistance variantPMID:26833155

>gb|ADT64081.1|+|MexS [Pseudomonas aeruginosa PAK]
MSRVIRFHQFGPPEVLKCEELPTPAPAAGEVLVRVQAIGVSWKDVLWRQNLAPEQAALPS
GLGFELAGEVLAVGAGVGDLPLGSRVASFPAHTPDHYPAYGDVVLMPRAALAVYPEVLTP
VEASVYYTGLLVAYFGLVDLAGLKAGQTVLITEAARMYGPVSIQLAKALGARVIASTKSA
EEREFLREQGADKVVVTDEQDLVLEVERFTEGKGVNVILDELGGPQMTLLGDVSATRGKL
VLYGCNGGNESAFPACAAFKKHLQFYRHCLMDFTGHPEMGLERNDESVSKALAHIEQLTR
DRLLKPVVDRVFEFDQVVEAHRYMETCPKRGRVVIHVAD



>gb|HQ433550.1|+|1-1020|MexS [Pseudomonas aeruginosa PAK]
ATGTCCCGAGTGATCCGTTTTCATCAGTTTGGCCCGCCAGAGGTCCTCAAATGCGAAGAGCTGCCGACCCCGGCGCCGGCCGCAGGGGAA
GTCCTGGTGCGTGTCCAGGCGATCGGCGTGAGCTGGAAGGATGTGCTCTGGCGTCAGAACCTGGCCCCGGAGCAGGCTGCGCTGCCGTCC
GGTCTCGGCTTCGAACTGGCCGGCGAGGTGCTGGCGGTCGGCGCCGGCGTCGGCGACCTGCCGCTGGGTTCCCGCGTGGCCAGTTTCCCC
GCCCATACCCCCGATCATTATCCGGCCTATGGCGACGTGGTGCTGATGCCGCGCGCGGCCCTGGCGGTCTACCCCGAGGTACTCACCCCG
GTGGAGGCCAGCGTCTACTACACCGGCCTGCTGGTGGCCTATTTCGGCCTGGTCGACCTGGCCGGGTTGAAGGCCGGGCAGACCGTGCTG
ATCACCGAGGCGGCGCGCATGTACGGGCCGGTCTCGATCCAGTTGGCCAAGGCTCTCGGCGCGCGGGTGATCGCTTCCACCAAGTCCGCC
GAGGAGCGCGAGTTCCTCCGCGAGCAGGGCGCCGACAAGGTGGTGGTGACCGACGAGCAGGACCTGGTCCTGGAAGTCGAGCGCTTCACC
GAGGGCAAGGGCGTCAATGTCATCCTCGACGAATTGGGCGGTCCGCAGATGACCCTGCTCGGCGATGTCTCCGCCACCCGCGGCAAGCTG
GTGCTGTATGGCTGCAACGGCGGCAACGAGTCGGCGTTCCCGGCCTGCGCCGCGTTCAAGAAGCACCTGCAGTTCTACCGCCACTGCCTG
ATGGATTTCACCGGTCATCCGGAGATGGGCCTGGAACGCAACGACGAGTCGGTGAGCAAGGCCCTCGCGCACATCGAGCAACTGACCCGC
GATCGCCTGCTCAAACCGGTGGTCGACCGGGTATTCGAGTTCGACCAGGTGGTCGAGGCGCACCGCTACATGGAAACCTGTCCAAAGCGC
GGCCGGGTGGTGATCCACGTCGCCGATTGA

Curator Acknowledgements
Curator Description Most Recent Edit