SHV-12

Download Sequences

Accession	ARO:3001071
Synonym(s)	SHV-5-2a
CARD Short Name	SHV-12
Definition	SHV-12 is an extended-spectrum beta-lactamase found in Acinetobacter baumannii.
AMR Gene Family	SHV beta-lactamase
Drug Class	cephalosporin, penicillin beta-lactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^p, Bacillus subtilis^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Citrobacter youngae^wgs, Cronobacter malonaticus^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^g+p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p+wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia stuartii^p, Pseudomonas aeruginosa^wgs, Raoultella planticola^p+wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^p, Bacillus subtilis^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Citrobacter youngae^wgs, Cronobacter malonaticus^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^g+p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p+wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia stuartii^p, Pseudomonas aeruginosa^wgs, Raoultella planticola^p+wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactam antibiotic + beta-lactamase + class A beta-lactamase + cephalosporin [Drug Class] + third-generation cephalosporin + first-generation cephalosporin + SHV-LEN beta-lactamase + penicillin beta-lactam [Drug Class]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic ceftriaxone [Antibiotic] + SHV beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)	1 ontology terms \| Show + Xeruborbactam [Adjuvant] is_small_molecule_inhibitor
Publications	Nuesch-Inderbinen MT, et al. 1997. Antimicrob Agents Chemother 41(5): 943-949. Survey and molecular genetics of SHV beta-lactamases in Enterobacteriaceae in Switzerland: two novel enzymes, SHV-11 and SHV-12. (PMID 9145849)

Resistomes

Prevalence of SHV-12 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0.18%	0%	0.14%	0%	0%
Acinetobacter baumannii	0.18%	0%	0.17%	0%	0%
Aeromonas hydrophila	0%	1.3%	0.81%	0%	0%
Aeromonas hydrophila	0%	1.3%	0.81%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%	0%
Aeromonas veronii	0%	1.54%	0%	0%	0%
Bacillus subtilis	0%	0%	0.29%	0%	0%
Bacillus subtilis	0%	0%	0.29%	0%	0%
Citrobacter amalonaticus	0%	0%	9.09%	0%	0%
Citrobacter amalonaticus	0%	0%	9.09%	0%	0%
Citrobacter freundii	0%	1.23%	13.73%	0%	0%
Citrobacter freundii	0%	1.23%	13.73%	0%	0%
Citrobacter portucalensis	0%	0%	10.81%	0%	0%
Citrobacter portucalensis	0%	0%	10.81%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Cronobacter malonaticus	0%	0%	1.82%	0%	0%
Cronobacter malonaticus	0%	0%	1.82%	0%	0%
Enterobacter asburiae	0%	0.28%	10.67%	0%	0%
Enterobacter asburiae	0%	0.28%	11.86%	0%	0%
Enterobacter chengduensis	0%	0%	8%	0%	0%
Enterobacter chengduensis	0%	0%	12%	0%	0%
Enterobacter cloacae	0%	3.91%	6.39%	0%	0%
Enterobacter cloacae	0%	3.91%	6.39%	0%	0%
Enterobacter hormaechei	0.36%	3.8%	20.59%	0%	0%
Enterobacter hormaechei	0.36%	3.8%	20.63%	0%	0%
Enterobacter kobei	0%	2.76%	10.92%	0%	0%
Enterobacter kobei	0%	2.76%	10.92%	0%	0%
Enterobacter roggenkampii	0%	0.48%	3.96%	0%	0%
Enterobacter roggenkampii	0%	0.48%	3.96%	0%	0%
Escherichia coli	0.02%	0.1%	0.92%	0%	0%
Escherichia coli	0.02%	0.1%	0.92%	0%	0%
Escherichia fergusonii	0%	0%	3.26%	0%	0%
Escherichia fergusonii	0%	0%	3.26%	0%	0%
Klebsiella aerogenes	0%	0%	2.54%	0%	0%
Klebsiella aerogenes	0%	0%	2.54%	0%	0%
Klebsiella michiganensis	1.61%	2.29%	2.39%	0%	0%
Klebsiella michiganensis	1.61%	2.29%	2.39%	0%	0%
Klebsiella oxytoca	0%	0%	1.68%	0%	0%
Klebsiella oxytoca	0%	0%	1.68%	0%	0%
Klebsiella pneumoniae	2.13%	2.47%	7.64%	0%	0%
Klebsiella pneumoniae	2.13%	2.47%	7.53%	0%	0%
Klebsiella quasipneumoniae	0%	1.27%	5.39%	0%	0%
Klebsiella quasipneumoniae	0%	1.27%	5.39%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	37.21%	0%	0%
Leclercia adecarboxylata	14.29%	4.76%	37.21%	0%	0%
Morganella morganii	0%	0%	0.61%	0%	0%
Morganella morganii	0%	0%	0.61%	0%	0%
Proteus mirabilis	0%	0%	0.5%	0%	0%
Proteus mirabilis	0%	0%	0.5%	0%	0%
Providencia stuartii	0%	6.82%	0%	0%	0%
Providencia stuartii	0%	6.82%	0%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Raoultella planticola	0%	2.33%	2.56%	0%	0%
Raoultella planticola	0%	2.33%	2.56%	0%	0%
Salmonella enterica	0%	0.05%	0.19%	0%	0%
Salmonella enterica	0%	0.05%	0.19%	0%	0%
Serratia marcescens	0%	1.94%	3.28%	0%	0%
Serratia marcescens	0%	1.94%	3.28%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550

Protein
DNA

>gb|AHN60527.1|+|SHV-12 [Enterobacter cloacae]
MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERK
IHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERN
QQIAGIGAALIEHWQR

>gb|KF976405.1|+|7838-8698|SHV-12 [Enterobacter cloacae]
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAA
CAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAA
CGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAG
ATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCC
GCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAG
ATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCC
AGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGAT
CGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAGCGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAAT
CAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

SHV-12

Prevalence: protein homolog model (view sequences)

Graph