SHV-12

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001071
Synonym(s)SHV-5-2a
CARD Short NameSHV-12
DefinitionSHV-12 is an extended-spectrum beta-lactamase found in Acinetobacter baumannii.
AMR Gene FamilySHV beta-lactamase
Drug Classcephalosporin, penicillin beta-lactam
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (66), Klebsiella pneumoniae (56), Enterobacter cloacae (22), Salmonella (11), Enterobacteriaceae (7), Serratia marcescens (6), Salmonella enterica (5), Pseudomonas aeruginosa (5), Citrobacter freundii (4), Acinetobacter baumannii (4)
GAZ[Former] State of Korea (8), Republic of China (4), Kingdom of Spain (3), Iran (3), Europe (3), China (2), New Delhi (2), Norway (2), Turkey (2), Egypt (2)
FOODONswine (6), poultry drumstick (5), meat (skinless) (4), chicken (3)
ENVOhospital (11), farm (5)
UBERONfeces (4), animal hemisphere (2)
Classification16 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ SHV beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)
1 ontology terms | Show
+ xeruborbactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniip, Bacillus subtiliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniip, Bacillus subtiliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs
Publications

Nuesch-Inderbinen MT, et al. 1997. Antimicrob Agents Chemother 41(5): 943-949. Survey and molecular genetics of SHV beta-lactamases in Enterobacteriaceae in Switzerland: two novel enzymes, SHV-11 and SHV-12. (PMID 9145849)

Resistomes

Prevalence of SHV-12 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.17%0%0%
Aeromonas hydrophila0%1.3%0.81%0%0%
Aeromonas veronii0%1.54%0%0%0%
Bacillus subtilis0%0%0.29%0%0%
Citrobacter amalonaticus0%0%9.09%0%0%
Citrobacter freundii0%1.23%13.73%0%0%
Citrobacter portucalensis0%0%10.81%0%0%
Citrobacter youngae0%0%6.25%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Enterobacter asburiae0%0.28%11.86%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae0%3.91%6.39%0%0%
Enterobacter hormaechei0.36%3.8%20.63%0%0%
Enterobacter kobei0%2.76%10.92%0%0%
Enterobacter roggenkampii0%0.48%3.96%0%0%
Escherichia coli0.02%0.1%0.92%0%0%
Escherichia fergusonii0%0%3.26%0%0%
Klebsiella aerogenes0%0%2.54%0%0%
Klebsiella michiganensis1.61%2.29%2.39%0%0%
Klebsiella oxytoca0%0%1.68%0%0%
Klebsiella pneumoniae2.13%2.47%7.64%0%0%
Klebsiella quasipneumoniae0%1.27%5.39%0%0%
Leclercia adecarboxylata14.29%4.76%37.21%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0%0%0.5%0%0%
Providencia stuartii0%6.82%0%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Raoultella planticola0%2.33%2.56%0%0%
Salmonella enterica0%0.05%0.19%0%0%
Serratia marcescens0%1.94%3.28%0%0%
Shigella sonnei0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AHN60527.1|+|SHV-12 [Enterobacter cloacae]
MRYIRLCIISLLATLPLAVHASPQPLEQIKQSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERK
IHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERN
QQIAGIGAALIEHWQR


>gb|KF976405.1|+|7838-8698|SHV-12 [Enterobacter cloacae]
ATGCGTTATATTCGCCTGTGTATTATCTCCCTGTTAGCCACCCTGCCGCTGGCGGTACACGCCAGCCCGCAGCCGCTTGAGCAAATTAAA
CAAAGCGAAAGCCAGCTGTCGGGCCGCGTAGGCATGATAGAAATGGATCTGGCCAGCGGCCGCACGCTGACCGCCTGGCGCGCCGATGAA
CGCTTTCCCATGATGAGCACCTTTAAAGTAGTGCTCTGCGGCGCAGTGCTGGCGCGGGTGGATGCCGGTGACGAACAGCTGGAGCGAAAG
ATCCACTATCGCCAGCAGGATCTGGTGGACTACTCGCCGGTCAGCGAAAAACACCTTGCCGACGGCATGACGGTCGGCGAACTCTGCGCC
GCCGCCATTACCATGAGCGATAACAGCGCCGCCAATCTGCTGCTGGCCACCGTCGGCGGCCCCGCAGGATTGACTGCCTTTTTGCGCCAG
ATCGGCGACAACGTCACCCGCCTTGACCGCTGGGAAACGGAACTGAATGAGGCGCTTCCCGGCGACGCCCGCGACACCACTACCCCGGCC
AGCATGGCCGCGACCCTGCGCAAGCTGCTGACCAGCCAGCGTCTGAGCGCCCGTTCGCAACGGCAGCTGCTGCAGTGGATGGTGGACGAT
CGGGTCGCCGGACCGTTGATCCGCTCCGTGCTGCCGGCGGGCTGGTTTATCGCCGATAAGACCGGAGCTAGCAAGCGGGGTGCGCGCGGG
ATTGTCGCCCTGCTTGGCCCGAATAACAAAGCAGAGCGCATTGTGGTGATTTATCTGCGGGATACGCCGGCGAGCATGGCCGAGCGAAAT
CAGCAAATCGCCGGGATCGGCGCGGCGCTGATCGAGCACTGGCAACGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit