mdtM

Accession ARO:3001214
Synonym(s)ECK4328 JW4300 yjiO
DefinitionMultidrug resistance protein MdtM
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, nucleoside antibiotic, nitroimidazole antibiotic, antibacterial free fatty acids, fluoroquinolone antibiotic, rhodamine, cephalosporin, glycylcycline, macrolide antibiotic, lincosamide antibiotic, bicyclomycin, benzalkonium chloride, peptide antibiotic, oxazolidinone antibiotic, isoniazid, phenicol antibiotic, diaminopyrimidine antibiotic, acridine dye, fosfomycin, rifamycin antibiotic, penam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs
Classification31 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic puromycin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Holdsworth SR and Law CJ. 2013. J Antimicrob Chemother 68(4): 831-839. The major facilitator superfamily transporter MdtM contributes to the intrinsic resistance of Escherichia coli to quaternary ammonium compounds. (PMID 23221628)

Resistomes

Prevalence of mdtM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Escherichia coli11.38%0%73.98%
Haemophilus influenzae0%0%0.15%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0%
Shigella dysenteriae88.89%0%62.86%
Shigella flexneri3.03%0%3.64%
Shigella sonnei0%0%3.92%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|AAC77293.1|-|mdtM [Escherichia coli str. K-12 substr. MG1655]
MPRFFTRHAATLFFPMALILYDFAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAGGMALQWLLGPLSDRIGRRPVLITGALIFTL
ACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFIS
FVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGAATISLSYIPMMSWVAVSPVILIDAGSLTTSQFAWTQVPVFGAVIVANAI
VARFVKDPTEPRFIWRAVPIQLVGLSLLIVGNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNKLPKGTVSASLNMVILMVMSVS
VEIGRWLWFNGGRLPFHLLAVVAGVIVVFTLAGLLNRVRQHQAAELVEEQ


>gb|U00096.3|-|4567287-4568519|mdtM [Escherichia coli str. K-12 substr. MG1655]
ATGCCACGTTTTTTTACCCGCCATGCCGCCACGCTGTTTTTCCCGATGGCGTTGATTTTGTATGACTTTGCTGCGTATCTGTCGACGGAT
CTGATCCAGCCTGGGATCATTAATGTGGTACGTGATTTTAATGCCGATGTCAGTCTGGCCCCTGCTGCCGTCAGTCTCTATCTTGCTGGC
GGTATGGCGTTACAGTGGCTGCTGGGGCCGCTTTCCGACAGAATTGGCCGCAGGCCGGTGCTGATTACCGGGGCGCTAATTTTTACCCTT
GCCTGCGCCGCGACAATGTTCACAACGTCTATGACACAGTTTCTTATCGCGCGTGCAATTCAGGGCACCAGTATCTGTTTTATTGCCACC
GTTGGTTATGTCACGGTGCAGGAGGCGTTCGGACAGACAAAAGGGATCAAGTTGATGGCGATTATCACCTCCATCGTACTGATTGCGCCG
ATTATCGGCCCGCTTTCCGGCGCAGCTCTGATGCACTTTATGCACTGGAAAGTCCTTTTTGCCATCATTGCGGTTATGGGTTTTATCTCA
TTTGTTGGCTTACTGTTGGCGATGCCAGAGACGGTGAAGCGCGGCGCGGTTCCGTTTAGCGCCAAAAGCGTCTTGCGCGATTTTCGTAAT
GTCTTTTGCAATCGGCTGTTCCTCTTTGGCGCAGCAACCATCTCTTTAAGCTATATCCCGATGATGAGCTGGGTGGCTGTCTCGCCGGTG
ATCCTTATCGATGCAGGCAGCTTAACAACTTCGCAGTTCGCCTGGACACAGGTTCCGGTGTTCGGCGCGGTGATTGTTGCGAATGCCATC
GTGGCGCGTTTTGTTAAAGATCCGACCGAACCGCGGTTTATCTGGCGTGCCGTACCCATTCAACTGGTCGGCCTCTCGCTGTTGATTGTC
GGCAATCTGCTGTCGCCGCACGTCTGGCTGTGGTCGGTGCTGGGCACCAGTCTGTATGCTTTCGGGATTGGTTTGATTTTCCCGACCTTA
TTCCGCTTTACGCTGTTTTCCAATAAGTTACCGAAAGGGACCGTCTCCGCATCGCTAAATATGGTGATCCTGATGGTGATGTCGGTCTCG
GTCGAAATCGGCCGCTGGCTATGGTTTAACGGCGGTCGCTTGCCGTTTCATCTGTTAGCCGTTGTGGCGGGCGTTATCGTCGTTTTCACC
CTGGCGGGATTGCTCAATCGCGTGCGCCAGCATCAGGCAGCCGAGCTAGTGGAGGAGCAGTGA