mdtM

Accession ARO:3001214
Synonym(s)ECK4328 JW4300 yjiO
CARD Short NamemdtM
DefinitionMultidrug resistance protein MdtM.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classnucleoside antibiotic, lincosamide antibiotic, fluoroquinolone antibiotic, phenicol antibiotic, disinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesEscherichia colig+wgs
Resistomes with Sequence VariantsBifidobacterium animaliswgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaewgs, Haemophilus influenzaewgs, Klebsiella pneumoniaewgs, Mycobacterium aviumwgs, Salmonella entericawgs, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Staphylococcus aureuswgs
Classification12 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic puromycin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Holdsworth SR and Law CJ. 2013. J Antimicrob Chemother 68(4): 831-839. The major facilitator superfamily transporter MdtM contributes to the intrinsic resistance of Escherichia coli to quaternary ammonium compounds. (PMID 23221628)

Resistomes

Prevalence of mdtM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Bifidobacterium animalis0%0%1.27%0%
Enterobacter hormaechei0%0%0.05%0%
Enterobacter kobei0%0%0.52%0%
Enterobacter roggenkampii0%0%0.4%0%
Escherichia albertii0%0%3.23%0%
Escherichia coli55.45%0.02%59.66%0%
Escherichia fergusonii96.49%0%43.66%0%
Escherichia marmotae0%0%2.17%0%
Haemophilus influenzae0%0%0.14%0%
Klebsiella pneumoniae0%0%0.08%0%
Mycobacterium avium0%0%0.48%0%
Salmonella enterica0%0%0.04%0%
Serratia marcescens0%0%0.14%0%
Shigella boydii100%0%90.11%0%
Shigella dysenteriae100%0%66.67%0%
Shigella flexneri56.45%0%3.67%0%
Shigella sonnei12.5%0%4.07%0%
Staphylococcus aureus0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|AAC77293.1|-|mdtM [Escherichia coli str. K-12 substr. MG1655]
MPRFFTRHAATLFFPMALILYDFAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAGGMALQWLLGPLSDRIGRRPVLITGALIFTL
ACAATMFTTSMTQFLIARAIQGTSICFIATVGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFIS
FVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGAATISLSYIPMMSWVAVSPVILIDAGSLTTSQFAWTQVPVFGAVIVANAI
VARFVKDPTEPRFIWRAVPIQLVGLSLLIVGNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNKLPKGTVSASLNMVILMVMSVS
VEIGRWLWFNGGRLPFHLLAVVAGVIVVFTLAGLLNRVRQHQAAELVEEQ


>gb|U00096.3|-|4567287-4568519|mdtM [Escherichia coli str. K-12 substr. MG1655]
ATGCCACGTTTTTTTACCCGCCATGCCGCCACGCTGTTTTTCCCGATGGCGTTGATTTTGTATGACTTTGCTGCGTATCTGTCGACGGAT
CTGATCCAGCCTGGGATCATTAATGTGGTACGTGATTTTAATGCCGATGTCAGTCTGGCCCCTGCTGCCGTCAGTCTCTATCTTGCTGGC
GGTATGGCGTTACAGTGGCTGCTGGGGCCGCTTTCCGACAGAATTGGCCGCAGGCCGGTGCTGATTACCGGGGCGCTAATTTTTACCCTT
GCCTGCGCCGCGACAATGTTCACAACGTCTATGACACAGTTTCTTATCGCGCGTGCAATTCAGGGCACCAGTATCTGTTTTATTGCCACC
GTTGGTTATGTCACGGTGCAGGAGGCGTTCGGACAGACAAAAGGGATCAAGTTGATGGCGATTATCACCTCCATCGTACTGATTGCGCCG
ATTATCGGCCCGCTTTCCGGCGCAGCTCTGATGCACTTTATGCACTGGAAAGTCCTTTTTGCCATCATTGCGGTTATGGGTTTTATCTCA
TTTGTTGGCTTACTGTTGGCGATGCCAGAGACGGTGAAGCGCGGCGCGGTTCCGTTTAGCGCCAAAAGCGTCTTGCGCGATTTTCGTAAT
GTCTTTTGCAATCGGCTGTTCCTCTTTGGCGCAGCAACCATCTCTTTAAGCTATATCCCGATGATGAGCTGGGTGGCTGTCTCGCCGGTG
ATCCTTATCGATGCAGGCAGCTTAACAACTTCGCAGTTCGCCTGGACACAGGTTCCGGTGTTCGGCGCGGTGATTGTTGCGAATGCCATC
GTGGCGCGTTTTGTTAAAGATCCGACCGAACCGCGGTTTATCTGGCGTGCCGTACCCATTCAACTGGTCGGCCTCTCGCTGTTGATTGTC
GGCAATCTGCTGTCGCCGCACGTCTGGCTGTGGTCGGTGCTGGGCACCAGTCTGTATGCTTTCGGGATTGGTTTGATTTTCCCGACCTTA
TTCCGCTTTACGCTGTTTTCCAATAAGTTACCGAAAGGGACCGTCTCCGCATCGCTAAATATGGTGATCCTGATGGTGATGTCGGTCTCG
GTCGAAATCGGCCGCTGGCTATGGTTTAACGGCGGTCGCTTGCCGTTTCATCTGTTAGCCGTTGTGGCGGGCGTTATCGTCGTTTTCACC
CTGGCGGGATTGCTCAATCGCGTGCGCCAGCATCAGGCAGCCGAGCTAGTGGAGGAGCAGTGA