ErmS

Accession ARO:3001304
Synonym(s)ermSF tlrA
CARD Short NameErmS
DefinitionErmS is a methyltransferase found in the tylosin producer Streptomyces fradiae. Like other Erm enzymes, it catalyzes the methylation of A2058 of the 23S ribosomal RNA. Specifically, this enzyme transfers two methyl groups. The gene is found within the tylosin biosynthetic cluster and is responsible for self-resistance.
AMR Gene FamilyErm 23S ribosomal RNA methyltransferase
Drug Classstreptogramin antibiotic, lincosamide antibiotic, streptogramin B antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
Classification13 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ Erm 23S ribosomal RNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic carbomycin [Antibiotic]
+ confers_resistance_to_antibiotic niddamycin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
Publications

Kelemen GH, et al. 1994. Mol Microbiol 14(4): 833-842. Transcriptional attenuation control of the tylosin-resistance gene tlrA in Streptomyces fradiae. (PMID 7534372)

Zalacain M, et al. 1989. J Bacteriol 171(8): 4254-4260. Methylation of 23S rRNA caused by tlrA (ermSF), a tylosin resistance determinant from Streptomyces fradiae. (PMID 2753855)

Kovalic D, et al. 1995. Biochemistry 34(48): 15838-15844. Methylation of minimalist 23S rRNA sequences in vitro by ErmSF (TlrA) N-methyltransferase. (PMID 7495815)

Birmingham VA, et al. 1986. Mol Gen Genet 204(3): 532-539. Cloning and expression of a tylosin resistance gene from a tylosin-producing strain of Streptomyces fradiae. (PMID 3020383)

Kamimiya S, et al. 1988. J Bacteriol 170(4): 1800-1811. Translational attenuation control of ermSF, an inducible resistance determinant encoding rRNA N-methyltransferase from Streptomyces fradiae. (PMID 3127381)

Kovalic D, et al. 1994. J Bacteriol 176(22): 6992-6998. 23S rRNA domain V, a fragment that can be specifically methylated in vitro by the ErmSF (TlrA) methyltransferase. (PMID 7961463)

Resistomes

Prevalence of ErmS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAA26742.1|+|ErmS [Streptomyces fradiae]
MARAPRSPHPARSRETSRAHPPYGTRADRAPGRGRDRDRSPDSPGNTSSRDGGRSPDRARRELSQNFLARRAVAERVARLVRPAPGGLLL
EVGAGRGVLTEALAPYCGRLVAHEIDPRLLPALRDRFGGPHHAHVRISGGDFLAAPVPREPFALAGNIPYSRTAGIVDWALRARTLTSAT
FVTQLEYARKRTGDYGRWSLLTVRTWPRHEWRLLGRVSRREFRPVPRVDSGILRIERRERPLLPSAALGDYHRMVELGFSGVGGSLYASL
RRAHRAGPLDAAFRAARLDRSVVVAYVTPEQWLTVFRTLRPVRSRPAGR


>gb|M19269.1|+|460-1419|ErmS [Streptomyces fradiae]
GTGGCCCGTGCACCCCGATCGCCCCACCCTGCCCGCTCGCGGGAGACCTCCCGCGCCCACCCGCCGTACGGCACCCGTGCGGATCGCGCC
CCCGGCCGTGGCCGTGACCGTGACCGCAGCCCCGACAGCCCCGGCAACACCAGCAGCCGCGACGGCGGCCGCAGCCCCGACCGCGCGCGG
CGCGAGCTCTCGCAGAACTTCCTCGCCCGCCGGGCCGTCGCCGAGCGCGTCGCGCGCCTGGTCCGGCCGGCCCCCGGCGGTCTGTTGCTG
GAGGTCGGCGCCGGGCGCGGCGTCCTGACCGAGGCGCTGGCCCCGTACTGCGGGCGGCTGGTCGCCCACGAGATCGACCCCCGTCTGCTG
CCGGCGCTGCGCGACCGGTTCGGCGGCCCGCACCATGCCCATGTGCGGATCAGCGGCGGCGACTTCCTGGCAGCCCCCGTCCCCCGTGAG
CCGTTCGCCCTCGCGGGGAACATCCCCTACTCCCGGACCGCGGGAATCGTGGACTGGGCGCTGCGGGCGCGCACGCTCACCTCGGCGACC
TTCGTCACCCAGCTCGAGTACGCCCGCAAGCGGACCGGCGACTATGGACGCTGGAGCCTGCTGACGGTGCGGACCTGGCCCCGCCACGAG
TGGCGGCTGCTCGGCAGGGTCTCCCGCCGGGAGTTCCGGCCGGTGCCCCGCGTGGACTCGGGCATCCTCCGGATCGAGCGGCGCGAGCGG
CCCCTGCTGCCGTCCGCCGCCCTCGGCGACTACCACCGCATGGTGGAGCTGGGTTTCTCCGGCGTGGGCGGATCGCTGTACGCATCGCTG
CGCCGGGCCCACCGGGCGGGGCCGCTCGACGCCGCGTTCCGTGCCGCGCGGCTGGACCGCTCCGTCGTCGTCGCGTATGTCACACCGGAG
CAGTGGCTCACGGTCTTCCGCACGTTGCGGCCCGTCCGCAGCCGACCGGCCGGACGGTGA