OXA-10

Download Sequences

Accession	ARO:3001405
Synonym(s)	PSE-2
CARD Short Name	OXA-10
Definition	OXA-10 is a beta-lactamase found in Acinetobacter baumannii and P. aeruginosa.
AMR Gene Family	OXA beta-lactamase, OXA-10-like beta-lactamase
Drug Class	penam, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Achromobacter xylosoxidans^wgs, Acinetobacter baumannii^g+wgs, Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p+wgs, Aeromonas veronii^g+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^p+wgs, Proteus vulgaris^p+wgs, Providencia heimbachae^p, Providencia rettgeri^p+wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas putida^p, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs, Shewanella putrefaciens^p, Shigella sonnei^wgs, Stenotrophomonas maltophilia^g, Vibrio alginolyticus^wgs, Vibrio cholerae^wgs, Vibrio fluvialis^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Achromobacter xylosoxidans^wgs, Acinetobacter baumannii^g+wgs, Acinetobacter pittii^wgs, Aeromonas caviae^g+wgs+gi, Aeromonas hydrophila^g+p+wgs, Aeromonas veronii^g+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^p+wgs, Proteus vulgaris^p+wgs, Providencia heimbachae^p, Providencia rettgeri^p+wgs, Providencia stuartii^p+wgs, Pseudomonas aeruginosa^g+p+wgs+gi, Pseudomonas putida^p, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs, Shewanella putrefaciens^p, Shigella sonnei^wgs, Stenotrophomonas maltophilia^g, Vibrio alginolyticus^wgs, Vibrio cholerae^wgs, Vibrio fluvialis^wgs, Vibrio parahaemolyticus^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic inactivation enzyme + beta-lactam antibiotic + hydrolysis of antibiotic conferring resistance + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penam [Drug Class] + beta-lactamase + class D beta-lactamase + oxacillin [Antibiotic] + cephem + OXA beta-lactamase [AMR Gene Family] + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + OXA-10-like beta-lactamase [AMR Gene Family]
Sub-Term(s)	1 ontology terms \| Show + enmetazobactam [Adjuvant] is_small_molecule_inhibitor
Publications	Paetzel M, et al. 2000. Nat Struct Biol 7(10): 918-925. Crystal structure of the class D beta-lactamase OXA-10. (PMID 11017203) Simo Tchuinte PL, et al. 2016. Int. J. Antimicrob. Agents : Characterisation of class 3 integrons with oxacillinase gene cassettes in hospital sewage and sludge samples from France and Luxembourg. (PMID 27499434)

Resistomes

Prevalence of OXA-10 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Achromobacter xylosoxidans	0%	0%	1.53%	0%
Achromobacter xylosoxidans	0%	0%	1.53%	0%
Acinetobacter baumannii	0.35%	0%	0.04%	0%
Acinetobacter baumannii	0.35%	0%	0.04%	0%
Acinetobacter pittii	0%	0%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%
Aeromonas caviae	6.82%	0%	2.15%	33.33%
Aeromonas caviae	6.82%	0%	2.15%	33.33%
Aeromonas hydrophila	3.08%	2.6%	0.81%	0%
Aeromonas hydrophila	3.08%	2.6%	0.81%	0%
Aeromonas veronii	5.45%	0%	1.12%	0%
Aeromonas veronii	5.45%	0%	1.12%	0%
Citrobacter freundii	0%	0.92%	2.9%	0%
Citrobacter freundii	0%	0.92%	3.09%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Enterobacter asburiae	0%	0%	1.98%	0%
Enterobacter asburiae	0%	0%	1.98%	0%
Enterobacter cloacae	0%	0.56%	0.96%	0%
Enterobacter cloacae	0%	0.56%	0.96%	0%
Enterobacter hormaechei	0%	0.13%	1.6%	0%
Enterobacter hormaechei	0%	0.13%	1.55%	0%
Enterobacter kobei	0%	0%	1.31%	0%
Enterobacter kobei	0%	0%	1.31%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%
Escherichia coli	0.02%	0.3%	0.64%	0%
Escherichia coli	0.02%	0.3%	0.63%	0%
Escherichia fergusonii	0%	0.71%	6.52%	0%
Escherichia fergusonii	0%	0.71%	6.52%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%
Klebsiella michiganensis	0%	0.57%	0.53%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella oxytoca	0%	0.68%	0.84%	0%
Klebsiella pneumoniae	0%	0.54%	0.98%	0%
Klebsiella pneumoniae	0%	0.54%	0.99%	0%
Klebsiella quasipneumoniae	0%	0.64%	5.53%	0%
Klebsiella quasipneumoniae	0%	0.64%	5.53%	0%
Morganella morganii	5.77%	0%	1.23%	0%
Morganella morganii	5.77%	0%	1.23%	0%
Proteus mirabilis	0%	6.25%	1.16%	0%
Proteus mirabilis	0%	6.25%	1.16%	0%
Proteus vulgaris	0%	11.11%	5.56%	0%
Proteus vulgaris	0%	11.11%	5.56%	0%
Providencia heimbachae	0%	100%	0%	0%
Providencia heimbachae	0%	100%	0%	0%
Providencia rettgeri	0%	5.41%	16.56%	0%
Providencia rettgeri	0%	5.41%	15.92%	0%
Providencia stuartii	0%	13.64%	9.09%	0%
Providencia stuartii	0%	13.64%	9.09%	0%
Pseudomonas aeruginosa	3.83%	1.17%	1.85%	12.5%
Pseudomonas aeruginosa	3.83%	1.17%	1.89%	13.89%
Pseudomonas putida	0%	4%	0%	0%
Pseudomonas putida	0%	4%	0%	0%
Pseudomonas stutzeri	0%	0%	7.63%	0%
Pseudomonas stutzeri	0%	0%	7.63%	0%
Salmonella enterica	0%	0.16%	0.12%	0%
Salmonella enterica	0%	0.16%	0.13%	0%
Serratia marcescens	0%	0%	0.26%	0%
Serratia marcescens	0%	0%	0.26%	0%
Shewanella putrefaciens	0%	20%	0%	0%
Shewanella putrefaciens	0%	20%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%
Shigella sonnei	0%	0%	0.07%	0%
Stenotrophomonas maltophilia	1.12%	0%	0%	0%
Stenotrophomonas maltophilia	1.12%	0%	0%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%
Vibrio alginolyticus	0%	0%	0.4%	0%
Vibrio cholerae	0%	0%	0.32%	0%
Vibrio cholerae	0%	0%	0.32%	0%
Vibrio fluvialis	0%	0%	4%	0%
Vibrio fluvialis	0%	0%	4%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAG45720.1|+|OXA-10 [Escherichia coli]
MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVF
KWDGKPRAMKQWERDLTLRGAIQVSAVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSA
SKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMDIDNESKLPLRKSIPTKIMESEGIIGG

>gb|AF205943.1|+|7512-8312|OXA-10 [Escherichia coli]
ATGAAAACATTTGCCGCATATGTAATTATCGCGTGTCTTTCGAGTACGGCATTAGCTGGTTCAATTACAGAAAATACGTCTTGGAACAAA
GAGTTCTCTGCCGAAGCCGTCAATGGTGTCTTCGTGCTTTGTAAAAGTAGCAGTAAATCCTGCGCTACCAATGACTTAGCTCGTGCATCA
AAGGAATATCTTCCAGCATCAACATTTAAGATCCCCAACGCAATTATCGGCCTAGAAACTGGTGTCATAAAGAATGAGCATCAGGTTTTC
AAATGGGACGGAAAGCCAAGAGCCATGAAGCAATGGGAAAGAGACTTGACCTTAAGAGGGGCAATACAAGTTTCAGCTGTTCCCGTATTT
CAACAAATCGCCAGAGAAGTTGGCGAAGTAAGAATGCAGAAATACCTTAAAAAATTTTCCTATGGCAACCAGAATATCAGTGGTGGCATT
GACAAATTCTGGTTGGAAGGCCAGCTTAGAATTTCCGCAGTTAATCAAGTGGAGTTTCTAGAGTCTCTATATTTAAATAAATTGTCAGCA
TCTAAAGAAAACCAGCTAATAGTAAAAGAGGCTTTGGTAACGGAGGCGGCACCTGAATATCTAGTGCATTCAAAAACTGGTTTTTCTGGT
GTGGGAACTGAGTCAAATCCTGGTGTCGCATGGTGGGTTGGGTGGGTTGAGAAGGAGACAGAGGTTTACTTTTTCGCCTTTAACATGGAT
ATAGACAACGAAAGTAAGTTGCCGCTAAGAAAATCCATTCCCACCAAAATCATGGAAAGTGAGGGCATCATTGGTGGCTAA

OXA-10

Prevalence: protein homolog model (view sequences)

Graph