OXA-50

Accession ARO:3001796
DefinitionOXA-50 is a beta-lactamase found in Pseudomonas aeruginosa. It confers decreased susceptibility to ampicillin and ticarcillin and, interestingly, to moxalactam and meropenem in P. aeruginosa but not in E. coli. Also confers resistance to piperacillin-tazobactam and cephalotin.
AMR Gene FamilyOXA beta-lactamase
Drug Classpenam, cephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsEscherichia coliwgs, Pseudomonas aeruginosag+wgs, Pseudomonas fluorescensg, Vibrio vulnificuswgs
Classification14 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ OXA beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Publications

Girlich D, et al. 2004. Antimicrob Agents Chemother 48(6): 2043-2048. Biochemical characterization of the naturally occurring oxacillinase OXA-50 of Pseudomonas aeruginosa. (PMID 15155197)

Resistomes

Prevalence of OXA-50 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Escherichia coli0%0%0.01%
Klebsiella pneumoniae0%0%0%
Proteus penneri0%0%0%
Pseudomonas aeruginosa75.1%0%71.59%
Pseudomonas fluorescens3.85%0%0%
Vibrio vulnificus0%0%0.62%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AAQ76277.1|+|OXA-50 [Pseudomonas aeruginosa]
MRPLLFSALLLLSGHTQASEWNDSQAVDKLFGAAGVKGTFVLYDVQRQRYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVLP
YGGKPQRFKAWEHDMSLRDAIKASNVPVYQELARRIGLERMRANVSRLGYGNAEIGQVVDNFWLVGPLKISAMEQTRFLLRLAQGELPFP
APVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWWVGWVKRNERLYGFALNIDMPGGEADIGKRVELGKASLKALGILP


>gb|AY306130|+|1-789|OXA-50 [Pseudomonas aeruginosa]
ATGCGCCCTCTCCTCTTCAGTGCCCTTCTCCTGCTTTCCGGGCATACCCAGGCCAGCGAATGGAACGACAGCCAGGCCGTGGACAAGCTA
TTCGGCGCGGCCGGGGTGAAAGGCACCTTCGTCCTCTACGATGTGCAGCGGCAGCGCTATGTTGGCCATGACCGGGAGCGCGCGGAAACC
CGCTTCGTTCCCGCTTCCACCTACAAGGTGGCGAACAGCCTGATCGGCTTATCCACAGGGGCGGTTAGATCCGCCGACGAGGTTCTTCCC
TATGGCGGCAAGCCCCAGCGCTTCAAGGCCTGGGAGCACGACATGAGCCTGCGCGACGCGATCAAGGCATCGAACGTACCGGTCTACCAG
GAACTGGCGCGGCGCATCGGCCTGGAGCGGATGCGCGCCAATGTCTCGCGCCTGGGTTACGGCAACGCGGAAATCGGCCAGGTTGTGGAT
AACTTCTGGTTGGTGGGACCGCTGAAGATCAGCGCGATGGAACAGACCCGCTTTCTGCTCCGACTGGCGCAGGGAGAATTGCCATTCCCC
GCCCCGGTGCAGTCCACCGTGCGCGCCATGACCCTGCTGGAAAGCGGCCCGGGCTGGGAGCTGCACGGCAAGACCGGCTGGTGCTTCGAC
TGCACGCCGGAACTCGGCTGGTGGGTGGGCTGGGTGAAGCGCAACGAGCGGCTCTACGGCTTCGCCCTGAACATCGACATGCCCGGCGGC
GAGGCCGACATCGGCAAGCGCGTCGAACTGGGCAAGGCCAGTCTCAAGGCTCTCGGGATACTGCCCTGA