AAC(3)-IVa

Accession ARO:3002539
Synonym(s)aacC4
CARD Short NameAAC(3)-IVa
DefinitionAAC(3)-IV is a plasmid-encoded aminoglycoside acetyltransferase in E. coli, C. jejuni and P. stutzeri.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEscherichia colig+p, Klebsiella pneumoniaeg+p, Klebsiella quasipneumoniaep, Morganella morganiig, Proteus columbaeg, Proteus mirabilisg+p, Proteus vulgarisp, Providencia alcalifaciensg, Providencia rettgerig+p, Providencia stuartiig, Pseudomonas aeruginosap, Salmonella entericag+p, Shigella flexnerig+p
Resistomes with Sequence VariantsAcinetobacter baumanniip, Acinetobacter townerip, Citrobacter freundiip, Escherichia colig+p, Escherichia fergusoniip, Klebsiella michiganensisp, Klebsiella oxytocap, Klebsiella pneumoniaeg+p, Klebsiella quasipneumoniaep, Morganella morganiig, Proteus columbaeg, Proteus mirabilisg+p, Proteus vulgarisp, Providencia alcalifaciensg, Providencia rettgerig+p, Providencia stuartiig, Pseudomonas aeruginosap, Salmonella entericag+p, Shigella flexnerig+p
Classification12 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 6'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic]
+ confers_resistance_to_antibiotic apramycin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ AAC(3)-IV
Publications

Brau B, et al. 1984. Mol Gen Genet 193(1): 179-187. Genes for gentamicin-(3)-N-acetyltransferases III and IV: I. Nucleotide sequence of the AAC(3)-IV gene and possible involvement of an IS140 element in its expression. (PMID 6318050)

Heuer H, et al. 2002. FEMS Microbiol Ecol 42(2): 289-302. Gentamicin resistance genes in environmental bacteria: prevalence and transfer. (PMID 19709289)

Resistomes

Prevalence of AAC(3)-IVa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 381 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0.05%0%0%
Acinetobacter towneri0%18.75%0%0%
Citrobacter freundii0%0.31%0%0%
Escherichia coli0.26%0.64%0%0%
Escherichia fergusonii0%2.85%0%0%
Klebsiella michiganensis0%0.57%0%0%
Klebsiella oxytoca0%1.37%0%0%
Klebsiella pneumoniae1.07%0.45%0%0%
Klebsiella quasipneumoniae0%0.42%0%0%
Morganella morganii11.54%0%0%0%
Proteus columbae100%0%0%0%
Proteus mirabilis34.86%3.75%0%0%
Proteus vulgaris0%11.11%0%0%
Providencia alcalifaciens18.18%0%0%0%
Providencia rettgeri5.88%5.41%0%0%
Providencia stuartii6.25%0%0%0%
Pseudomonas aeruginosa0%0.29%0%0%
Salmonella enterica1.26%5.47%0%0%
Shigella flexneri1%0.8%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ABB43029.1|+|AAC(3)-IVa [Escherichia coli]
MQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFW
RLPNVKRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLHLAELMAKVPYGVPRHCTILQDGKLVR
VDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG


>gb|DQ241380.1|+|1-777|AAC(3)-IVa [Escherichia coli]
GTGCAATACGAATGGCGAAAAGCCGAGCTCATCGGTCAGCTTCTCAACCTTGGGGTTACCCCCGGCGGTGTGCTGCTGGTCCACAGCTCC
TTCCGTAGCGTCCGGCCCCTCGAAGATGGGCCACTTGGACTGATCGAGGCCCTGCGTGCTGCGCTGGGTCCGGGAGGGACGCTCGTCATG
CCCTCGTGGTCAGGTCTGGACGACGAGCCGTTCGATCCTGCCACGTCGCCCGTTACACCGGACCTTGGAGTTGTCTCTGACACATTCTGG
CGCCTGCCAAATGTAAAGCGCAGCGCCCATCCATTTGCCTTTGCGGCAGCGGGGCCACAGGCAGAGCAGATCATCTCTGATCCATTGCCC
CTGCCACCTCACTCGCCTGCAAGCCCGGTCGCCCGTGTCCATGAACTCGATGGGCAGGTACTTCTCCTCGGCGTGGGACACGATGCCAAC
ACGACGCTGCATCTTGCCGAGTTGATGGCAAAGGTTCCCTATGGGGTGCCGAGACACTGCACCATTCTTCAGGATGGCAAGTTGGTACGC
GTCGATTATCTCGAGAATGACCACTGCTGTGAGCGCTTTGCCTTGGCGGACAGGTGGCTCAAGGAGAAGAGCCTTCAGAAGGAAGGTCCA
GTCGGTCATGCCTTTGCTCGGTTGATCCGCTCCCGCGACATTGTGGCGACAGCCCTGGGTCAACTGGGCCGAGATCCGTTGATCTTCCTG
CATCCGCCAGAGGCGGGATGCGAAGAATGCGATGCCGCTCGCCAGTCGATTGGCTGA