AAC(3)-IVa

Download Sequences

Accession	ARO:3002539
Synonym(s)	aacC4
CARD Short Name	AAC(3)-IVa
Definition	AAC(3)-IV is a plasmid-encoded aminoglycoside acetyltransferase in E. coli, C. jejuni and P. stutzeri.
AMR Gene Family	AAC(3)
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Acinetobacter johnsonii^wgs, Acinetobacter towneri^wgs, Citrobacter freundii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter roggenkampii^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus columbae^g, Proteus mirabilis^g+p+wgs, Proteus vulgaris^p+wgs, Providencia alcalifaciens^g, Providencia rettgeri^g+p+wgs, Providencia stuartii^g, Pseudomonas aeruginosa^p+wgs, Pseudomonas putida^wgs, Salmonella enterica^g+p+wgs, Shigella flexneri^g+p, Shigella sonnei^wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^p+wgs, Acinetobacter johnsonii^wgs, Acinetobacter towneri^p+wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Citrobacter youngae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter roggenkampii^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella michiganensis^p, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus columbae^g, Proteus mirabilis^g+p+wgs, Proteus penneri^wgs, Proteus vulgaris^p+wgs, Providencia alcalifaciens^g, Providencia rettgeri^g+p+wgs, Providencia stuartii^g, Pseudomonas aeruginosa^p+wgs, Pseudomonas putida^wgs, Salmonella enterica^g+p+wgs, Shigella flexneri^g+p, Shigella sonnei^wgs, Streptococcus suis^wgs, Vibrio parahaemolyticus^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + antibiotic mixture + AAC(3) [AMR Gene Family]
Parent Term(s)	9 ontology terms \| Show + confers_resistance_to_antibiotic dibekacin [Antibiotic] + confers_resistance_to_antibiotic sisomicin [Antibiotic] + confers_resistance_to_antibiotic apramycin [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic 6'-N-ethylnetilmicin [Antibiotic] + confers_resistance_to_antibiotic 2'-N-ethylnetilmicin [Antibiotic] + confers_resistance_to_antibiotic gentamicin [Antibiotic] + AAC(3)-IV
Publications	Brau B, et al. 1984. Mol Gen Genet 193(1): 179-187. Genes for gentamicin-(3)-N-acetyltransferases III and IV: I. Nucleotide sequence of the AAC(3)-IV gene and possible involvement of an IS140 element in its expression. (PMID 6318050) Heuer H, et al. 2002. FEMS Microbiol Ecol 42(2): 289-302. Gentamicin resistance genes in environmental bacteria: prevalence and transfer. (PMID 19709289)

Resistomes

Prevalence of AAC(3)-IVa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0.05%	0.03%	0%	0%
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Acinetobacter johnsonii	0%	0%	1.82%	0%	0%
Acinetobacter johnsonii	0%	0%	1.82%	0%	0%
Acinetobacter towneri	0%	0%	3.85%	0%	0%
Acinetobacter towneri	0%	18.75%	3.85%	0%	0%
Citrobacter freundii	0%	0%	0.58%	0%	0%
Citrobacter freundii	0%	0.31%	0.58%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter hormaechei	0%	0%	0.22%	0%	0%
Enterobacter hormaechei	0%	0%	0.26%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Escherichia albertii	0%	0%	1.94%	0%	0%
Escherichia albertii	0%	0%	2.58%	0%	0%
Escherichia coli	0.26%	0.23%	1.28%	0%	0.18%
Escherichia coli	0.26%	0.64%	3.29%	0%	0.22%
Escherichia fergusonii	0%	2.85%	18.48%	0%	0%
Escherichia fergusonii	0%	0%	2.17%	0%	0%
Klebsiella michiganensis	0%	0.57%	0%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella oxytoca	0%	1.37%	0%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella pneumoniae	1.07%	0.25%	1.39%	0%	0%
Klebsiella pneumoniae	1.07%	0.45%	2.58%	0%	0%
Klebsiella quasipneumoniae	0%	0.42%	3.82%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	3.29%	0%	0%
Morganella morganii	11.54%	0%	7.98%	0%	0%
Morganella morganii	11.54%	0%	4.29%	0%	0%
Proteus columbae	100%	0%	0%	0%	0%
Proteus columbae	100%	0%	0%	0%	0%
Proteus mirabilis	34.86%	1.25%	9.9%	0%	0%
Proteus mirabilis	34.86%	3.75%	24.42%	0%	0%
Proteus penneri	0%	0%	25%	0%	0%
Proteus penneri	0%	0%	0%	0%	0%
Proteus vulgaris	0%	11.11%	11.11%	0%	0%
Proteus vulgaris	0%	11.11%	5.56%	0%	0%
Providencia alcalifaciens	18.18%	0%	0%	0%	0%
Providencia alcalifaciens	18.18%	0%	0%	0%	0%
Providencia rettgeri	5.88%	5.41%	1.91%	0%	0%
Providencia rettgeri	5.88%	5.41%	7.64%	0%	0%
Providencia stuartii	6.25%	0%	0%	0%	0%
Providencia stuartii	6.25%	0%	0%	0%	0%
Pseudomonas aeruginosa	0%	0.29%	0.04%	0%	0%
Pseudomonas aeruginosa	0%	0.29%	0.09%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Salmonella enterica	1.26%	2.9%	1.58%	0%	0%
Salmonella enterica	1.26%	5.47%	3.56%	0%	0%
Shigella flexneri	1%	0.8%	0%	0%	0%
Shigella flexneri	1%	0.4%	0%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%	0%
Streptococcus suis	0%	0%	0%	0%	0%
Streptococcus suis	0%	0%	0.05%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|ABB43029.1|+|AAC(3)-IVa [Escherichia coli]
MQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFW
RLPNVKRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLHLAELMAKVPYGVPRHCTILQDGKLVR
VDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG

>gb|DQ241380.1|+|1-777|AAC(3)-IVa [Escherichia coli]
GTGCAATACGAATGGCGAAAAGCCGAGCTCATCGGTCAGCTTCTCAACCTTGGGGTTACCCCCGGCGGTGTGCTGCTGGTCCACAGCTCC
TTCCGTAGCGTCCGGCCCCTCGAAGATGGGCCACTTGGACTGATCGAGGCCCTGCGTGCTGCGCTGGGTCCGGGAGGGACGCTCGTCATG
CCCTCGTGGTCAGGTCTGGACGACGAGCCGTTCGATCCTGCCACGTCGCCCGTTACACCGGACCTTGGAGTTGTCTCTGACACATTCTGG
CGCCTGCCAAATGTAAAGCGCAGCGCCCATCCATTTGCCTTTGCGGCAGCGGGGCCACAGGCAGAGCAGATCATCTCTGATCCATTGCCC
CTGCCACCTCACTCGCCTGCAAGCCCGGTCGCCCGTGTCCATGAACTCGATGGGCAGGTACTTCTCCTCGGCGTGGGACACGATGCCAAC
ACGACGCTGCATCTTGCCGAGTTGATGGCAAAGGTTCCCTATGGGGTGCCGAGACACTGCACCATTCTTCAGGATGGCAAGTTGGTACGC
GTCGATTATCTCGAGAATGACCACTGCTGTGAGCGCTTTGCCTTGGCGGACAGGTGGCTCAAGGAGAAGAGCCTTCAGAAGGAAGGTCCA
GTCGGTCATGCCTTTGCTCGGTTGATCCGCTCCCGCGACATTGTGGCGACAGCCCTGGGTCAACTGGGCCGAGATCCGTTGATCTTCCTG
CATCCGCCAGAGGCGGGATGCGAAGAATGCGATGCCGCTCGCCAGTCGATTGGCTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(3)-IVa

Prevalence: protein homolog model (view sequences)

Graph