AAC(6')-Ib-cr1

Download Sequences


Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002547
CARD Short NameAAC(6')-Ib-cr1
DefinitionAAC(6')-Ib-cr is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in Enterobacteriaceae. The aac(6')-Ib-cr variant gene can induce resistance against aminoglycoside and fluoroquinolone simultaneously.
AMR Gene FamilyAAC(6'), AAC(6')-Ib-cr
Drug Classaminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-Ib-cr [AMR Gene Family]
Resistomes with Perfect MatchesAeromonas veroniigi, Enterobacter hormaecheigi, Escherichia coligi, Klebsiella huaxiensisgi, Klebsiella pneumoniaegi, Laribacter hongkongensisgi, Morganella morganiigi, Proteus mirabilisgi, Salmonella entericagi
Resistomes with Sequence VariantsAeromonas veroniigi, Enterobacter hormaecheigi, Escherichia coliwgs+gi, Klebsiella huaxiensisgi, Klebsiella pneumoniaewgs+gi, Laribacter hongkongensisgi, Morganella morganiigi, Proteus mirabilisgi, Salmonella entericagi
Publications

Robicsek A, et al. 2006. Nat Med 12(1): 83-88. Fluoroquinolone-modifying enzyme: a new adaptation of a common aminoglycoside acetyltransferase. (PMID 16369542)

Shen P, et al. 2008. J Antimicrob Chemother 62(6): 1252-1256. Complete nucleotide sequence of pKP96, a 67 850 bp multiresistance plasmid encoding qnrA1, aac(6')-Ib-cr and blaCTX-M-24 from Klebsiella pneumoniae. (PMID 18812424)

Vetting MW, et al. 2008. Biochemistry 47(37): 9825-9835. Mechanistic and structural analysis of aminoglycoside N-acetyltransferase AAC(6')-Ib and its bifunctional, fluoroquinolone-active AAC(6')-Ib-cr variant. (PMID 18710261)

Resistomes

Prevalence of AAC(6')-Ib-cr1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas veronii0%0%0%12.5%0%
Enterobacter hormaechei0%0%0%6.67%0%
Escherichia coli0%0%0.01%1.15%0%
Klebsiella huaxiensis0%0%0%50%0%
Klebsiella pneumoniae0%0%0.06%5.71%0%
Laribacter hongkongensis0%0%0%50%0%
Morganella morganii0%0%0%7.69%0%
Proteus mirabilis0%0%0%25.93%0%
Salmonella enterica0%0%0%2.65%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 275


>gb|WP_071846215.1|+|AAC(6')-Ib-cr1 [Stenotrophomonas maltophilia]
MTNSNDSVTLRHMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERT
RSDA


>gb|NG_052213.1|+|101-655|AAC(6')-Ib-cr1 [Stenotrophomonas maltophilia]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCACATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit