AAC(6')-Ib-cr

Download Sequences


Accession ARO:3002547
DefinitionAAC(6')-Ib-cr is an aminoglycoside acetyltransferase encoded by plasmids, transposons, integrons in Enterobacteriaceae. The aac(6')-Ib-cr variant gene can induce resistance against aminoglycoside and fluoroquinolone simultaneously
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+p+wgs, Proteus mirabilisg+p+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+p+wgs, Proteus mirabilisg+p+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Classification20 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
Publications

Robicsek A, et al. 2006. Nat Med 12(1): 83-88. Fluoroquinolone-modifying enzyme: a new adaptation of a common aminoglycoside acetyltransferase. (PMID 16369542)

Shen P, et al. 2008. J Antimicrob Chemother 62(6): 1252-1256. Complete nucleotide sequence of pKP96, a 67 850 bp multiresistance plasmid encoding qnrA1, aac(6')-Ib-cr and blaCTX-M-24 from Klebsiella pneumoniae. (PMID 18812424)

Vetting MW, et al. 2008. Biochemistry 47(37): 9825-9835. Mechanistic and structural analysis of aminoglycoside N-acetyltransferase AAC(6')-Ib and its bifunctional, fluoroquinolone-active AAC(6')-Ib-cr variant. (PMID 18710261)

Resistomes

Prevalence of AAC(6')-Ib-cr among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.07%
Citrobacter amalonaticus0%0%15.62%
Citrobacter freundii0%8.49%17.83%
Citrobacter koseri0%0%3.45%
Enterobacter asburiae0%0%4.76%
Enterobacter cloacae4.65%3.45%8.01%
Enterobacter hormaechei3.23%5.49%18.95%
Enterobacter kobei0%0%2.9%
Escherichia coli0.66%0.94%5.57%
Klebsiella aerogenes0%2%3.29%
Klebsiella oxytoca0%3.33%1.95%
Klebsiella pneumoniae4.99%3.44%26.42%
Morganella morganii17.65%5.26%8.93%
Proteus mirabilis16.67%2.78%7.82%
Providencia rettgeri0%0%6.25%
Providencia stuartii0%0%4.17%
Pseudomonas aeruginosa0%0%0.18%
Raoultella planticola0%5.88%3.57%
Salmonella enterica0.7%2.07%0.8%
Serratia marcescens0%2.27%3.28%
Shigella flexneri0%6.58%0.5%
Shigella sonnei0%0%0.31%
Vibrio cholerae0%0%0.16%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 275


>gb|ABC17627.1|+|AAC(6')-Ib-cr [Escherichia coli]
MSNAKTKLGITKYSIVTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYA
QSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYG
PAVYMVQTRQAFERTRSDA


>gb|DQ303918|+|1-600|AAC(6')-Ib-cr [Escherichia coli]
ATGAGCAACGCAAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAG
CATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCGTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGAC
GTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCC
CAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAAT
GCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAA
ACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGT
CCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAA