AAC(6')-Ie-APH(2'')-Ia

Accession ARO:3002597
Synonym(s)aac(6')-bifunctional aacA-aphD APH(2''), aph(2'')-bifunctional, AAC(6')-APH(2'')
DefinitionAAC(6')-Ie-APH(2'')-Ia is an aminoglycoside acetyltransferase encoded by plasmids and transposons in S. aureus, E. faecalis, E. faecium and Staphylococcus warneri
AMR Gene FamilyAPH(2''), AAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCampylobacter coliwgs, Campylobacter jejuniwgs, Clostridioides difficileg+wgs, Clostridium perfringensg+wgs, Enterobacter cloacaewgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus pseudintermediusg+wgs, Streptococcus agalactiaeg+wgs, Streptococcus pneumoniaeg+wgs
Resistomes with Sequence VariantsCampylobacter colig+wgs, Campylobacter jejuniwgs, Clostridioides difficileg+wgs, Clostridium perfringensg+wgs, Enterobacter cloacaewgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Morganella morganiip, Pseudomonas aeruginosawgs, Serratia marcescenswgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus pseudintermediusg+wgs, Streptococcus agalactiaeg+wgs, Streptococcus pneumoniaeg+wgs
Classification23 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ APH(2'') [AMR Gene Family]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
Publications

Daigle DM, et al. 1999. Chem Biol 6(2): 99-110. Prodigious substrate specificity of AAC(6')-APH(2), an aminoglycoside antibiotic resistance determinant in enterococci and staphylococci. (PMID 10021417)

Rouch DA, et al. 1987. J Gen Microbiol 133(11): 3039-3052. The aacA-aphD gentamicin and kanamycin resistance determinant of Tn4001 from Staphylococcus aureus: expression and nucleotide sequence analysis. (PMID 2833561)

Resistomes

Prevalence of AAC(6')-Ie-APH(2'')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Campylobacter coli5.56%0%1.97%
Campylobacter jejuni0%0%0.07%
Clostridioides difficile6.15%0%10.18%
Clostridium perfringens6.25%0%1.67%
Enterobacter cloacae0%0%0.78%
Enterococcus faecalis1.69%11.11%24.9%
Enterococcus faecium5.96%12.43%39.07%
Escherichia coli0%0%0.03%
Klebsiella aerogenes0%0%0.47%
Klebsiella pneumoniae0%0%0.08%
Morganella morganii0%5.26%0%
Pseudomonas aeruginosa0%0%0.02%
Serratia marcescens0%0%0.18%
Staphylococcus aureus11.38%3.4%17.3%
Staphylococcus epidermidis35.29%8.82%35.99%
Staphylococcus pseudintermedius40%0%65.58%
Streptococcus agalactiae1.09%0%2.75%
Streptococcus pneumoniae1.59%0%0.04%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 900


>gb|AAA88548.1|-|AAC(6')-Ie-APH(2'')-Ia [Staphylococcus aureus]
MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELYTDYHYPK
TDEIVYGMDQFIGEPNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRYD
DNATNVKAMKYLIEHYFDNFKVDSIEIIGSGYDSVAYLVNNEYIFKTKFSTNKKKGYAKEKAIYNFLNTNLETNVKIPNIEYSYISDELS
ILGYKEIKGTFLTPEIYSTMSEEEQNLLKRDIASFLRQMHGLDYTDISECTIDNKQNVLEEYILLRETIYNDLTDIEKDYIESFMERLNA
TTVFEGKKCLCHNDFSCNHLLLDGNNRLTGIIDFGDSGIIDEYCDFIYLLEDSEEEIGTNFGEDILRMYGNIDIEKAKEYQDIVEEYYPI
ETIVYGIKNIKQEFIENGRKEIYKRTYKD


>gb|GU565967.1|-|24980-26419|AAC(6')-Ie-APH(2'')-Ia [Staphylococcus aureus]
ATGAATATAGTTGAAAATGAAATATGTATAAGAACTTTAATAGATGATGATTTTCCTTTGATGTTAAAATGGTTAACTGATGAAAGAGTA
TTAGAATTTTATGGTGGTAGAGATAAAAAATATACATTAGAATCATTAAAAAAACATTATACAGAGCCTTGGGAAGATGAAGTTTTTAGA
GTAATTATTGAATATAACAATGTTCCTATTGGATATGGACAAATATATAAAATGTATGATGAGTTATATACTGATTATCATTATCCAAAA
ACTGATGAGATAGTCTATGGTATGGATCAATTTATAGGAGAGCCAAATTATTGGAGTAAAGGAATTGGTACAAGATATATTAAATTGATT
TTTGAATTTTTGAAAAAAGAAAGAAATGCTAATGCAGTTATTTTAGACCCTCATAAAAATAATCCAAGAGCAATAAGGGCATACCAAAAA
TCTGGTTTTAGAATTATTGAAGATTTGCCAGAACATGAATTACACGAGGGCAAAAAAGAAGATTGTTATTTAATGGAATATAGATATGAT
GATAATGCCACAAATGTTAAGGCAATGAAATATTTAATTGAGCATTACTTTGATAATTTCAAAGTAGATAGTATTGAAATAATCGGTAGT
GGTTATGATAGTGTGGCATATTTAGTTAATAATGAATACATTTTTAAAACAAAATTTAGTACTAATAAGAAAAAAGGTTATGCAAAAGAA
AAAGCAATATATAATTTTTTAAATACAAATTTAGAAACTAATGTAAAAATTCCTAATATTGAATATTCGTATATTAGTGATGAATTATCT
ATACTAGGTTATAAAGAAATTAAAGGAACTTTTTTAACACCAGAAATTTATTCTACTATGTCAGAAGAAGAACAAAATTTGTTAAAACGA
GATATTGCCAGTTTTTTAAGACAAATGCACGGTTTAGATTATACAGATATTAGTGAATGTACTATTGATAATAAACAAAATGTATTAGAA
GAGTATATATTGTTGCGTGAAACTATTTATAATGATTTAACTGATATAGAAAAAGATTATATAGAAAGTTTTATGGAAAGACTAAATGCA
ACAACAGTTTTTGAGGGTAAAAAGTGTTTATGCCATAATGATTTTAGTTGTAATCATCTATTGTTAGATGGCAATAATAGATTAACTGGA
ATAATTGATTTTGGAGATTCTGGAATTATAGATGAATATTGTGATTTTATATACTTACTTGAAGATAGTGAAGAAGAAATAGGAACAAAT
TTTGGAGAAGATATATTAAGAATGTATGGAAATATAGATATTGAGAAAGCAAAAGAATATCAAGATATAGTTGAAGAATATTATCCTATT
GAAACTATTGTTTATGGAATTAAAAATATTAAACAGGAATTTATCGAAAATGGTAGAAAAGAAATTTATAAAAGGACTTATAAAGATTGA