APH(3')-Ia

Accession ARO:3002641
Synonym(s)aphA-1 apha1-1AB APH(3')-Ic apha7
DefinitionAPH(3')-Ia is a transposon-encoded aminoglycoside phosphotransferase in E. coli and S. enterica. It is identical at the protein sequence to APH(3')-Ic, an aminoglycoside phosphotransferase encoded by plasmids, transposons and genomic islands in K. pneumoniae, A. baumannii, S. marcescens, Corynebacterium spp., Photobacterium spp. and Citrobacter spp.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter haemolyticusp, Acinetobacter lwoffiiwgs, Citrobacter freundiip, Enterobacter cloacaep+wgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Haemophilus influenzaewgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaep+wgs, Morganella morganiip+wgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig, Providencia stuartiip, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap, Salmonella entericap+wgs, Serratia marcescensg+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter haemolyticusp, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Brucella abortusg+wgs, Burkholderia cepaciawgs, Burkholderia pseudomalleiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterococcus faeciumwgs, Escherichia colig+p+wgs, Francisella tularensiswgs, Haemophilus influenzaewgs, Klebsiella aerogenesg+p+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Legionella pneumophilawgs, Morganella morganiig+p+wgs, Mycobacterium tuberculosiswgs, Neisseria gonorrhoeaewgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap+wgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs, Serratia marcescensg+wgs, Shigella sonneiwgs, Staphylococcus aureuswgs, Staphylococcus epidermidiswgs, Stenotrophomonas maltophiliawgs, Streptococcus agalactiaewgs, Streptococcus pyogeneswgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Classification12 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3') [AMR Gene Family]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin A [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin B [Antibiotic]
Publications

Oka A, et al. 1981. J Mol Biol 147(2): 217-226. Nucleotide sequence of the kanamycin resistance transposon Tn903. (PMID 6270337)

Lee KY, et al. 1990. J Bacteriol 172(6): 3229-3236. Direct involvement of IS26 in an antibiotic resistance operon. (PMID 2160941)

Tauch A, et al. 2000. Mol Gen Genet 263(1): 1-11. The 51,409-bp R-plasmid pTP10 from the multiresistant clinical isolate Corynebacterium striatum M82B is composed of DNA segments initially identified in soil bacteria and in plant, animal, and human pathogens. (PMID 10732668)

Resistomes

Prevalence of APH(3')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii32.07%2.36%44.14%
Acinetobacter haemolyticus0%2.44%0%
Acinetobacter lwoffii0%0%5.26%
Acinetobacter nosocomialis0%1.92%2.2%
Brucella abortus1.22%0%0.6%
Burkholderia cepacia0%0%0.79%
Burkholderia pseudomallei0%0%0.07%
Citrobacter amalonaticus0%0%6.25%
Citrobacter freundii7.89%1.89%3.18%
Enterobacter asburiae0%0%2.38%
Enterobacter cloacae9.3%6.9%6.25%
Enterobacter hormaechei4.84%3.85%20.17%
Enterobacter kobei0%0%11.59%
Enterococcus faecium0%0%0.12%
Escherichia coli1.18%1.47%8.95%
Francisella tularensis0%0%0.18%
Haemophilus influenzae0%0%1.02%
Klebsiella aerogenes3.45%2%1.88%
Klebsiella oxytoca38.46%5%19.84%
Klebsiella pneumoniae1.2%2.91%21.45%
Legionella pneumophila0%0%0.41%
Morganella morganii17.65%5.26%16.07%
Mycobacterium tuberculosis0%0%0.02%
Neisseria gonorrhoeae0%0%0.17%
Proteus mirabilis28.57%11.11%40.78%
Proteus vulgaris0%50%10%
Providencia rettgeri12.5%20%6.25%
Providencia stuartii10%5.88%8.33%
Pseudomonas aeruginosa3.07%3.85%0.99%
Pseudomonas putida0%10%2.08%
Pseudomonas stutzeri0%0%2.78%
Salmonella enterica1.39%4.41%5%
Serratia liquefaciens0%0%0%
Serratia marcescens3.23%0%0.55%
Shigella sonnei0%0%0.47%
Staphylococcus aureus0%0%0.05%
Staphylococcus epidermidis0%0%0.13%
Stenotrophomonas maltophilia0%0%0.26%
Streptococcus agalactiae0%0%0.08%
Streptococcus pyogenes0%0%0.23%
Vibrio cholerae0%0%0.81%
Vibrio parahaemolyticus0%0%13.41%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAE51638.1|-|APH(3')-Ia [Serratia marcescens]
MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRT
PDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWK
EMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEF
F


>gb|BX664015.1|-|103018-103833|APH(3')-Ia [Serratia marcescens]
ATGAGCCATATTCAACGGGAAACGTCTTGCTCGAGGCCGCGATTAAATTCCAACCTGGATGCTGATTTATATGGGTATAGATGGGCTCGC
GATAATGTCGGGCAATCAGGTGCGACAATCTATCGATTGTATGGGAAGCCCAATGCGCCAGAGTTGTTTCTGAAACATGGCAAAGGTAGC
GTTGCCAATGATGTTACAGATGAGATGGTCAGACTAAACTGGCTGACGGCATTTATGCCTCTTCCGACCATCAAGCATTTTATCCGTACT
CCTGATGATGCATGGTTACTCACCACTGCGATCCCCGGGAAAACAGCATTCCAGGTATTAGAAGAATATCCTGATTCAGGTGAAAATATT
GTTGATGCGCTGGCAGTGTTCCTGCGCCGGTTGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGCGTATTTCGTCTCGCT
CAGGCGCAATCACGAATGAATAACGGTTTGGTTGATGCTAGTGATTTTGATGACGAGCGTAATGGCTGGCCTGTTGAACAAGTCTGGAAA
GAAATGCATAAGCTTTTGCCATTCTCACCGGATTCAGTCGTCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAA
TTAATAGGTTGTATTGATGTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCCTCGGTGAGTTTTCT
CCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTGATATGAATAAATTGCAGTTTCATTTGATGCTCGATGAGTTT
TTCTGA