APH(3')-Ia

Accession ARO:3002641
Synonym(s)aphA-1 apha1-1AB APH(3')-Ic apha7
CARD Short NameAPH(3')-Ia
DefinitionAPH(3')-Ia is a transposon-encoded aminoglycoside phosphotransferase in E. coli and S. enterica. It is identical at the protein sequence to APH(3')-Ic, an aminoglycoside phosphotransferase encoded by plasmids, transposons and genomic islands in K. pneumoniae, A. baumannii, S. marcescens, Corynebacterium spp., Photobacterium spp. and Citrobacter spp.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p, Acinetobacter defluviig, Acinetobacter haemolyticusp, Acinetobacter indicusp, Acinetobacter pittiip, Corynebacterium amycolatumg, Corynebacterium diphtheriaeg, Corynebacterium imitansg, Corynebacterium urealyticumg, Enterobacter cloacaep, Enterobacter hormaecheip, Escherichia colig+p, Haemophilus influenzaeg, Haemophilus parainfluenzaeg, Klebsiella michiganensisg+p, Klebsiella oxytocag, Klebsiella pneumoniaep, Morganella morganiip, Pasteurella multocidag, Proteus mirabilisg+p, Proteus vulgarisp, Providencia rettgerig, Providencia stuartiip, Pseudomonas aeruginosag+p, Pseudomonas putidap, Salmonella entericag+p, Serratia marcescensg, Vibrio choleraep
Resistomes with Sequence VariantsAcinetobacter baumanniig+p, Acinetobacter defluviig, Acinetobacter haemolyticusp, Acinetobacter indicusg+p, Acinetobacter nosocomialisp, Acinetobacter pittiip, Acinetobacter townerig+p, Actinobacillus indolicusg, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg, Aeromonas hydrophilag+p, Aeromonas veroniig, Avibacterium paragallinarumg, Brucella abortusg, Burkholderia cenocepaciag, Burkholderia glumaeg, Citrobacter freundiip, Citrobacter portucalensisp, Corynebacterium amycolatumg, Corynebacterium diphtheriaeg, Corynebacterium imitansg, Corynebacterium urealyticumg, Deinococcus radioduransg, Enterobacter asburiaeg, Enterobacter cloacaeg+p, Enterobacter hormaecheig+p, Enterobacter kobeip, Enterobacter roggenkampiip, Escherichia albertiig+p, Escherichia colig+p, Escherichia fergusoniip, Glaesserella parasuisg, Haemophilus influenzaeg, Haemophilus parainfluenzaeg, Histophilus somnig, Klebsiella aerogenesg+p, Klebsiella michiganensisg+p, Klebsiella oxytocag+p, Klebsiella pneumoniaeg+p, Klebsiella quasipneumoniaep, Laribacter hongkongensisg, Leclercia adecarboxylatap, Morganella morganiig+p, Mycobacterium tuberculosisg, Pasteurella multocidag, Proteus columbaeg, Proteus mirabilisg+p, Proteus vulgarisp, Providencia alcalifaciensg, Providencia rettgerig+p, Providencia stuartiig+p, Pseudomonas aeruginosag+p, Pseudomonas putidap, Pseudomonas stutzerig, Salmonella entericag+p, Serratia marcescensg+p, Shigella dysenteriaeg, Shigella flexnerig+p, Staphylococcus haemolyticusp, Vibrio alginolyticusp, Vibrio choleraep
Classification13 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ APH(3')-I
Publications

Oka A, et al. 1981. J Mol Biol 147(2): 217-226. Nucleotide sequence of the kanamycin resistance transposon Tn903. (PMID 6270337)

Lee KY, et al. 1990. J Bacteriol 172(6): 3229-3236. Direct involvement of IS26 in an antibiotic resistance operon. (PMID 2160941)

Tauch A, et al. 2000. Mol Gen Genet 263(1): 1-11. The 51,409-bp R-plasmid pTP10 from the multiresistant clinical isolate Corynebacterium striatum M82B is composed of DNA segments initially identified in soil bacteria and in plant, animal, and human pathogens. (PMID 10732668)

Resistomes

Prevalence of APH(3')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 381 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii37.35%0.57%0%0%
Acinetobacter defluvii100%0%0%0%
Acinetobacter haemolyticus0%2.44%0%0%
Acinetobacter indicus9.52%3.77%0%0%
Acinetobacter nosocomialis0%1.64%0%0%
Acinetobacter pittii0%1.97%0%0%
Acinetobacter towneri12.5%37.5%0%0%
Actinobacillus indolicus100%0%0%0%
Actinobacillus pleuropneumoniae2.78%0%0%0%
Aeromonas caviae9.09%0%0%0%
Aeromonas hydrophila4.62%3.9%0%0%
Aeromonas veronii1.82%0%0%0%
Avibacterium paragallinarum12.5%0%0%0%
Brucella abortus0.79%0%0%0%
Burkholderia cenocepacia18.59%0%0%0%
Burkholderia glumae3%0%0%0%
Citrobacter freundii0%1.23%0%0%
Citrobacter portucalensis0%8.82%0%0%
Corynebacterium amycolatum57.14%0%0%0%
Corynebacterium diphtheriae1.85%0%0%0%
Corynebacterium imitans100%0%0%0%
Corynebacterium urealyticum100%0%0%0%
Deinococcus radiodurans8%0%0%0%
Enterobacter asburiae3.23%0%0%0%
Enterobacter cloacae3.57%2.79%0%0%
Enterobacter hormaechei2.52%1.8%0%0%
Enterobacter kobei0%0.69%0%0%
Enterobacter roggenkampii0%0.48%0%0%
Escherichia albertii1.43%0.56%0%0%
Escherichia coli1.86%2.08%0%0%
Escherichia fergusonii0%3.56%0%0%
Glaesserella parasuis34.62%0%0%0%
Haemophilus influenzae1.03%0%0%0%
Haemophilus parainfluenzae6.25%0%0%0%
Histophilus somni46.67%0%0%0%
Klebsiella aerogenes4%1.09%0%0%
Klebsiella michiganensis40.32%5.14%0%0%
Klebsiella oxytoca17.95%2.74%0%0%
Klebsiella pneumoniae1.24%3.87%0%0%
Klebsiella quasipneumoniae0%1.69%0%0%
Laribacter hongkongensis66.67%0%0%0%
Leclercia adecarboxylata0%4.76%0%0%
Morganella morganii15.38%2.5%0%0%
Mycobacterium tuberculosis0.2%0%0%0%
Pasteurella multocida12.86%0%0%0%
Proteus columbae100%0%0%0%
Proteus mirabilis44.95%5%0%0%
Proteus vulgaris0%33.33%0%0%
Providencia alcalifaciens18.18%0%0%0%
Providencia rettgeri8.82%18.92%0%0%
Providencia stuartii6.25%6.82%0%0%
Pseudomonas aeruginosa1.38%2.05%0%0%
Pseudomonas putida0%20%0%0%
Pseudomonas stutzeri3.57%0%0%0%
Salmonella enterica2.27%7.17%0%0%
Serratia marcescens2.27%0.65%0%0%
Shigella dysenteriae14.29%0%0%0%
Shigella flexneri8%9.64%0%0%
Staphylococcus haemolyticus0%1.89%0%0%
Vibrio alginolyticus0%3.57%0%0%
Vibrio cholerae0%5.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAE51638.1|-|APH(3')-Ia [Serratia marcescens]
MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRT
PDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWK
EMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEF
F


>gb|BX664015.1|-|103018-103833|APH(3')-Ia [Serratia marcescens]
ATGAGCCATATTCAACGGGAAACGTCTTGCTCGAGGCCGCGATTAAATTCCAACCTGGATGCTGATTTATATGGGTATAGATGGGCTCGC
GATAATGTCGGGCAATCAGGTGCGACAATCTATCGATTGTATGGGAAGCCCAATGCGCCAGAGTTGTTTCTGAAACATGGCAAAGGTAGC
GTTGCCAATGATGTTACAGATGAGATGGTCAGACTAAACTGGCTGACGGCATTTATGCCTCTTCCGACCATCAAGCATTTTATCCGTACT
CCTGATGATGCATGGTTACTCACCACTGCGATCCCCGGGAAAACAGCATTCCAGGTATTAGAAGAATATCCTGATTCAGGTGAAAATATT
GTTGATGCGCTGGCAGTGTTCCTGCGCCGGTTGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGCGTATTTCGTCTCGCT
CAGGCGCAATCACGAATGAATAACGGTTTGGTTGATGCTAGTGATTTTGATGACGAGCGTAATGGCTGGCCTGTTGAACAAGTCTGGAAA
GAAATGCATAAGCTTTTGCCATTCTCACCGGATTCAGTCGTCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAA
TTAATAGGTTGTATTGATGTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCCTCGGTGAGTTTTCT
CCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTGATATGAATAAATTGCAGTTTCATTTGATGCTCGATGAGTTT
TTCTGA