APH(3')-Ia

Accession ARO:3002641
Synonym(s)aphA-1 apha1-1AB APH(3')-Ic apha7
CARD Short NameAPH(3')-Ia
DefinitionAPH(3')-Ia is a transposon-encoded aminoglycoside phosphotransferase in E. coli and S. enterica. It is identical at the protein sequence to APH(3')-Ic, an aminoglycoside phosphotransferase encoded by plasmids, transposons and genomic islands in K. pneumoniae, A. baumannii, S. marcescens, Corynebacterium spp., Photobacterium spp. and Citrobacter spp.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter defluviig, Acinetobacter haemolyticusp, Acinetobacter indicusp+wgs, Acinetobacter lwoffiiwgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter towneriwgs, Aeromonas hydrophilawgs, Citrobacter freundiiwgs, Corynebacterium amycolatumg+wgs, Corynebacterium diphtheriaeg+wgs, Corynebacterium imitansg, Corynebacterium jeikeiumwgs, Corynebacterium urealyticumg+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Faecalibacterium prausnitziiwgs, Haemophilus influenzaeg+wgs, Haemophilus parainfluenzaeg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaep+wgs, Moraxella osloensiswgs, Morganella morganiip+wgs, Neisseria siccawgs, Pasteurella multocidag+wgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig+wgs, Providencia stuartiip, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap, Salmonella entericag+p+wgs, Serratia marcescensg+wgs, Shigella sonneiwgs, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter defluviig, Acinetobacter haemolyticusp, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniiwgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerig+p+wgs, Actinobacillus indolicusg, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Alcaligenes faecaliswgs, Avibacterium paragallinarumg+wgs, Bacillus amyloliquefacienswgs, Bacillus cereuswgs, Bacillus pumiluswgs, Bacillus thuringiensiswgs, Bacillus velezensiswgs, Bartonella henselaewgs, Bordetella bronchisepticawgs, Brucella abortusg, Burkholderia cenocepaciag, Burkholderia cepaciawgs, Burkholderia pseudomalleiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Corynebacterium amycolatumg+wgs, Corynebacterium diphtheriaeg+wgs, Corynebacterium imitansg, Corynebacterium jeikeiumwgs, Corynebacterium urealyticumg+wgs, Cronobacter malonaticuswgs, Cronobacter sakazakiiwgs, Deinococcus radioduransg, Enterobacter asburiaeg+wgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Enterococcus faeciumwgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Faecalibacterium prausnitziiwgs, Francisella tularensiswgs, Gardnerella vaginaliswgs, Glaesserella parasuisg+wgs, Haemophilus influenzaeg+wgs, Haemophilus parainfluenzaeg, Histophilus somnig+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Lactobacillus gasseriwgs, Laribacter hongkongensisg+wgs, Leclercia adecarboxylatap, Legionella pneumophilawgs, Moraxella osloensiswgs, Morganella morganiig+p+wgs, Mycobacterium tuberculosisg+wgs, Neisseria gonorrhoeaewgs, Neisseria siccawgs, Pasteurella multocidag+wgs, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidap+wgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shewanella putrefaciensp+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p, Shigella sonneiwgs, Staphylococcus aureuswgs, Staphylococcus epidermidiswgs, Staphylococcus haemolyticusp, Stenotrophomonas maltophiliawgs, Streptococcus agalactiaewgs, Streptococcus dysgalactiaewgs, Streptococcus pneumoniaewgs, Streptococcus pseudopneumoniaewgs, Streptococcus pyogeneswgs, Streptococcus suiswgs, Trueperella pyogeneswgs, Vibrio alginolyticusp, Vibrio choleraep+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs
Classification12 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3') [AMR Gene Family]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin A [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin B [Antibiotic]
Publications

Oka A, et al. 1981. J Mol Biol 147(2): 217-226. Nucleotide sequence of the kanamycin resistance transposon Tn903. (PMID 6270337)

Lee KY, et al. 1990. J Bacteriol 172(6): 3229-3236. Direct involvement of IS26 in an antibiotic resistance operon. (PMID 2160941)

Tauch A, et al. 2000. Mol Gen Genet 263(1): 1-11. The 51,409-bp R-plasmid pTP10 from the multiresistant clinical isolate Corynebacterium striatum M82B is composed of DNA segments initially identified in soil bacteria and in plant, animal, and human pathogens. (PMID 10732668)

Resistomes

Prevalence of APH(3')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii39.95%1.15%31.39%0%
Acinetobacter defluvii100%0%0%0%
Acinetobacter haemolyticus0%2.44%0%0%
Acinetobacter indicus9.52%3.77%5.56%0%
Acinetobacter johnsonii0%0%4%0%
Acinetobacter lwoffii0%0%4.35%0%
Acinetobacter nosocomialis0%1.64%0.65%0%
Acinetobacter pittii0%2.11%3.95%0%
Acinetobacter radioresistens0%0%2.44%0%
Acinetobacter towneri12.5%37.5%5.26%0%
Actinobacillus indolicus100%0%0%0%
Aeromonas caviae12.9%0%8.97%0%
Aeromonas hydrophila6%6.67%4%0%
Aeromonas veronii3.23%0%1.28%0%
Alcaligenes faecalis0%0%3.85%0%
Avibacterium paragallinarum8.33%0%5.88%0%
Bacillus amyloliquefaciens0%0%1.35%0%
Bacillus cereus0%0%0.09%0%
Bacillus pumilus0%0%0.64%0%
Bacillus thuringiensis0%0%0.48%0%
Bacillus velezensis0%0%0.46%0%
Bartonella henselae0%0%8.33%0%
Bordetella bronchiseptica0%0%1.35%0%
Brucella abortus0.76%0%0%0%
Burkholderia cenocepacia18.59%0%0%0%
Burkholderia cepacia0%0%0.45%0%
Burkholderia pseudomallei0%0%0.06%0%
Citrobacter amalonaticus0%0%4.17%0%
Citrobacter freundii0.89%0.64%6.19%0%
Citrobacter portucalensis0%9.09%6.9%0%
Citrobacter werkmanii0%0%10.26%0%
Citrobacter youngae0%0%6.25%0%
Comamonas testosteroni0%0%6.67%0%
Corynebacterium amycolatum60%0%31.25%0%
Corynebacterium diphtheriae2.63%0%1.27%0%
Corynebacterium imitans100%0%0%0%
Corynebacterium jeikeium0%0%10.53%0%
Corynebacterium urealyticum100%0%60%0%
Cronobacter malonaticus0%0%1.82%0%
Cronobacter sakazakii0%0%0.24%0%
Deinococcus radiodurans8%0%0%0%
Enterobacter asburiae3.85%0%2.67%0%
Enterobacter cloacae3.85%3.12%5.4%0%
Enterobacter hormaechei2.55%2.31%10.74%0%
Enterobacter kobei0%0%5.67%0%
Enterobacter roggenkampii0%0.55%2.02%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii4.55%2.56%2.15%0%
Escherichia coli1.61%1.81%7.42%0%
Escherichia fergusonii0%3.38%12.68%0%
Faecalibacterium prausnitzii0%0%1.1%0%
Francisella tularensis0%0%0.38%0%
Gardnerella vaginalis0%0%0.97%0%
Glaesserella parasuis26.09%0%22.22%0%
Haemophilus influenzae1.05%0%1.14%0%
Haemophilus parainfluenzae6.25%0%0%0%
Histophilus somni48.28%0%44.83%0%
Klebsiella aerogenes4.65%1.28%0.93%0%
Klebsiella michiganensis46.15%2.96%42.09%0%
Klebsiella oxytoca21.21%3.28%4.9%0%
Klebsiella pneumoniae1.24%3.8%15.6%0%
Klebsiella quasipneumoniae0%1.89%3.12%0%
Lactobacillus gasseri0%0%2.04%0%
Laribacter hongkongensis66.67%0%2.08%0%
Leclercia adecarboxylata0%5.56%0%0%
Legionella pneumophila0%0%0.23%0%
Moraxella osloensis0%0%7.69%0%
Morganella morganii16%2.7%10.34%0%
Mycobacterium tuberculosis0.22%0%0.05%0%
Neisseria gonorrhoeae0%0%0.12%0%
Neisseria sicca0%0%7.69%0%
Pasteurella multocida14.17%0%16.53%0%
Proteus columbae100%0%0%0%
Proteus mirabilis45.05%7.46%21.28%0%
Proteus penneri0%0%16.67%0%
Proteus vulgaris0%25%6.67%0%
Providencia alcalifaciens18.18%0%0%0%
Providencia rettgeri9.38%19.44%8.09%0%
Providencia stuartii7.69%10.71%6.82%0%
Pseudomonas aeruginosa1.69%1.28%0.76%0%
Pseudomonas monteilii0%0%5%0%
Pseudomonas putida0%9.52%1.37%0%
Pseudomonas stutzeri0%0%1.92%0%
Salmonella enterica1.6%6.17%5.57%0%
Serratia marcescens2.48%0.66%1.52%0%
Shewanella putrefaciens0%22.22%9.09%0%
Shigella boydii0%0%5.49%0%
Shigella dysenteriae16.67%0%3.7%0%
Shigella flexneri12.9%14.29%0%0%
Shigella sonnei0%0%0.81%0%
Staphylococcus aureus0%0%0.06%0%
Staphylococcus epidermidis0%0%0.09%0%
Staphylococcus haemolyticus0%2.33%0%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Streptococcus agalactiae0%0%0.07%0%
Streptococcus dysgalactiae0%0%1.03%0%
Streptococcus pneumoniae0%0%0.01%0%
Streptococcus pseudopneumoniae0%0%1.71%0%
Streptococcus pyogenes0%0%0.15%0%
Streptococcus suis0%0%0.06%0%
Trueperella pyogenes0%0%10%0%
Vibrio alginolyticus0%3.57%0%0%
Vibrio cholerae0%5.88%0.76%0%
Vibrio parahaemolyticus0%0%11.38%0%
Vibrio vulnificus0%0%0.4%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAE51638.1|-|APH(3')-Ia [Serratia marcescens]
MSHIQRETSCSRPRLNSNLDADLYGYRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVANDVTDEMVRLNWLTAFMPLPTIKHFIRT
PDDAWLLTTAIPGKTAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFDDERNGWPVEQVWK
EMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEF
F


>gb|BX664015.1|-|103018-103833|APH(3')-Ia [Serratia marcescens]
ATGAGCCATATTCAACGGGAAACGTCTTGCTCGAGGCCGCGATTAAATTCCAACCTGGATGCTGATTTATATGGGTATAGATGGGCTCGC
GATAATGTCGGGCAATCAGGTGCGACAATCTATCGATTGTATGGGAAGCCCAATGCGCCAGAGTTGTTTCTGAAACATGGCAAAGGTAGC
GTTGCCAATGATGTTACAGATGAGATGGTCAGACTAAACTGGCTGACGGCATTTATGCCTCTTCCGACCATCAAGCATTTTATCCGTACT
CCTGATGATGCATGGTTACTCACCACTGCGATCCCCGGGAAAACAGCATTCCAGGTATTAGAAGAATATCCTGATTCAGGTGAAAATATT
GTTGATGCGCTGGCAGTGTTCCTGCGCCGGTTGCATTCGATTCCTGTTTGTAATTGTCCTTTTAACAGCGATCGCGTATTTCGTCTCGCT
CAGGCGCAATCACGAATGAATAACGGTTTGGTTGATGCTAGTGATTTTGATGACGAGCGTAATGGCTGGCCTGTTGAACAAGTCTGGAAA
GAAATGCATAAGCTTTTGCCATTCTCACCGGATTCAGTCGTCACTCATGGTGATTTCTCACTTGATAACCTTATTTTTGACGAGGGGAAA
TTAATAGGTTGTATTGATGTTGGACGAGTCGGAATCGCAGACCGATACCAGGATCTTGCCATCCTATGGAACTGCCTCGGTGAGTTTTCT
CCTTCATTACAGAAACGGCTTTTTCAAAAATATGGTATTGATAATCCTGATATGAATAAATTGCAGTTTCATTTGATGCTCGATGAGTTT
TTCTGA