Escherichia coli folP with mutation conferring resistance to sulfonamides

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003386
CARD Short NameEcol_folP_SLF
DefinitionPoint mutations in Escherichia coli dihydropteroate synthase folP prevent sulfonamide antibiotics from inhibiting its role in folate synthesis, thus conferring sulfonamide resistance.
AMR Gene Familysulfonamide resistant dihydropteroate synthase folP
Drug Classsulfone antibiotic, sulfonamide antibiotic
Resistance Mechanismantibiotic target alteration
Classification23 ontology terms | Show
Parent Term(s)10 ontology terms | Show
+ confers_resistance_to_antibiotic sulfadiazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadimidine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadoxine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfisoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfacetamide [Antibiotic]
+ confers_resistance_to_antibiotic mafenide [Antibiotic]
+ confers_resistance_to_antibiotic sulfasalazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethizole [Antibiotic]
+ sulfonamide resistant dihydropteroate synthase folP [AMR Gene Family]
Resistomes with Sequence VariantsCitrobacter portucalensisg, Enterobacter hormaecheiwgs, Escherichia colig+wgs, Klebsiella oxytocawgs, Salmonella entericag+wgs
Publications

Vedantam G, et al. 1998. Antimicrob Agents Chemother 42(1): 88-93. Characterization of mutations contributing to sulfathiazole resistance in Escherichia coli. (PMID 9449266)

Resistomes

Prevalence of Escherichia coli folP with mutation conferring resistance to sulfonamides among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter portucalensis3.7%0%0%0%0%
Enterobacter hormaechei0%0%0.13%0%0%
Escherichia coli0.02%0%0.09%0%0.13%
Klebsiella oxytoca0%0%0.42%0%0%
Salmonella enterica0.06%0%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 500

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
P64Lsingle resistance variantPMID:9449266
P64Asingle resistance variantPMID:9449266
P64Rsingle resistance variantPMID:9449266
P64Hsingle resistance variantPMID:9449266
P64Ssingle resistance variantPMID:9449266

>gb|AAC76209.2|-|Escherichia coli folP with mutation conferring resistance to sulfonamides [Escherichia coli str. K-12 substr. MG1655]
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE



>gb|U00096.3|-|3324063-3324911|Escherichia coli folP with mutation conferring resistance to sulfonamides [Escherichia coli str. K-12 substr. MG1655]
ATGAAACTCTTTGCCCAGGGTACTTCACTGGACCTTAGCCATCCTCACGTAATGGGGATCCTCAACGTCACGCCTGATTCCTTTTCGGAT
GGTGGCACGCATAACTCGCTGATAGATGCGGTGAAACATGCGAATCTGATGATCAACGCTGGCGCGACGATCATTGACGTTGGTGGCGAG
TCCACGCGCCCAGGGGCGGCGGAAGTTAGCGTTGAAGAAGAGTTGCAACGTGTTATTCCTGTGGTTGAGGCAATTGCTCAACGCTTCGAA
GTCTGGATCTCAGTCGATACATCCAAACCAGAAGTCATCCGTGAGTCAGCGAAAGTTGGCGCTCACATTATTAATGATATCCGCTCCCTT
TCCGAACCTGGCGCTCTGGAGGCGGCTGCAGAAACCGGTTTACCGGTTTGTCTGATGCATATGCAGGGAAATCCAAAAACCATGCAGGAA
GCTCCGAAGTATGACGATGTCTTTGCAGAAGTGAATCGCTACTTTATTGAGCAAATAGCACGTTGCGAGCAGGCGGGTATCGCAAAAGAG
AAATTGTTGCTCGACCCCGGATTCGGTTTCGGTAAAAATCTCTCCCATAACTATTCATTACTGGCGCGCCTGGCTGAATTTCACCATTTC
AACCTGCCGCTGTTGGTGGGTATGTCACGAAAATCGATGATTGGGCAGCTGCTGAACGTGGGGCCGTCCGAGCGCCTGAGCGGTAGTCTG
GCCTGTGCGGTCATTGCCGCAATGCAAGGCGCGCACATCATTCGTGTTCATGACGTCAAAGAAACCGTAGAAGCGATGCGGGTGGTGGAA
GCCACTCTGTCTGCAAAGGAAAACAAACGCTATGAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit